Poecilia reticulata (guppy): 103470987 Help Entry 103470987         CDS       T05149                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism pret  Poecilia reticulata (guppy) Pathway pret03030   DNA replication pret03410   Base excision repair pret03420   Nucleotide excision repair pret03430   Mismatch repair pret03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pret00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     103470987 (pold4)    03410 Base excision repair     103470987 (pold4)    03420 Nucleotide excision repair     103470987 (pold4)    03430 Mismatch repair     103470987 (pold4)    03440 Homologous recombination     103470987 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pret03032]     103470987 (pold4)    03400 DNA repair and recombination proteins [BR:pret03400]     103470987 (pold4) DNA replication proteins [BR:pret03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     103470987 (pold4) DNA repair and recombination proteins [BR:pret03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       103470987 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      103470987 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  103470987 NCBI-ProteinID:  XP_008417960 LinkDB All DBs Position LG1:complement(28899278..28903995) Genome browser AA seq 94 aa AA seqDB search MTTKRGLITDSFKVLKKTRRGGKRKKSPTPPPALQGEAALRLNDSGLLSGISRMQRWERA KLHGLNPPEEIKELLLQTLDDPEYSMSLWREYPF NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgacaacaaaacgtggactgataaccgattcatttaaagtgctgaagaaaacaaggaga gggggaaagcgaaagaagagtcccacgcctcctccagcacttcaaggtgaggcagcgctc aggctaaacgattctggtctgttgtcaggcatcagcagaatgcagaggtgggagagagcg aagcttcatggtctgaacccacctgaggaaatcaaagagctgttgctgcaaacactcgat gatcctgagtactccatgagcctctggagagaatatccgttctga

DBGET integrated database retrieval system