Poecilia reticulata (guppy): 103478173 Help Entry 103478173         CDS       T05149                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism pret  Poecilia reticulata (guppy) Pathway pret04382   Cornified envelope formation pret05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pret00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     103478173  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103478173  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pret04147]     103478173 Exosome [BR:pret04147]  Exosomal proteins   Exosomal proteins of microglial cells    103478173 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_6 Nop5_N EF-hand_8 DEK_C Motif Other DBs NCBI-GeneID:  103478173 NCBI-ProteinID:  XP_008429960 UniProt:  A0A3P9PV31 LinkDB All DBs Position LG16:15581812..15582933 Genome browser AA seq 99 aa AA seqDB search MTELEKSMESLITVFHRYAKEGGNKTTLSKKELKKLIENELPNFLTTQKNPDTVSCIIKD LDQNKDDELDFEEFVPFVAGLTIACEKHYALHHEKKGKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgactgagttggagaaatccatggagtccctgatcacggtgtttcaccgttacgccaag gaaggtggcaataaaacgaccctgagcaagaaggagctgaaaaagctgattgagaatgag ttgcccaacttcttaacaacccagaaaaaccccgacacggtgtcgtgcatcatcaaggat ctggaccagaacaaggacgatgagctggactttgaggaatttgtccccttcgtcgctgga ctgacaatcgcctgtgagaagcattacgctttgcaccacgaaaagaagggcaagaagtga

DBGET integrated database retrieval system