Poecilia reticulata (guppy): 103480193 Help Entry 103480193         CDS       T05149                                  Name (RefSeq) C-C motif chemokine 13-like   KO K05408   C-C motif chemokine 3 Organism pret  Poecilia reticulata (guppy) Pathway pret04060   Cytokine-cytokine receptor interaction pret04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:pret00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103480193  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103480193  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pret04052]     103480193    00536 Glycosaminoglycan binding proteins [BR:pret00536]     103480193 Cytokines and neuropeptides [BR:pret04052]  Cytokines   Chemokines    103480193 Glycosaminoglycan binding proteins [BR:pret00536]  Heparan sulfate / Heparin   Chemokines    103480193 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103480193 NCBI-ProteinID:  XP_008433293 UniProt:  A0A3P9QDZ3 LinkDB All DBs Position LG18:complement(1629369..1630547) Genome browser AA seq 93 aa AA seqDB search MKAERVFLLCILGAALLSTVLCTNGIGPDDCCFKFYPRQMRKSAIRSYYFTDYRCPKAAV ILVTGQKGRHICVDPSLLWVENMMRHLDEKDLK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggccgaacgcgtcttcctgctctgcatcctgggagccgctctgctgtccactgtc ctctgcaccaatggaattggacccgacgactgctgcttcaaattctatccacgacagatg aggaaatctgccatccgctcgtactacttcactgattaccgctgtcccaaggctgcagtc attttggtcacaggacagaagggtcgtcacatctgcgtggatccaagtctcctgtgggtt gaaaacatgatgaggcatctggatgagaaggacttgaagtga

DBGET integrated database retrieval system