Poecilia reticulata (guppy): 103481258 Help Entry 103481258         CDS       T05149                                  Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism pret  Poecilia reticulata (guppy) Pathway pret04137   Mitophagy - animal pret04144   Endocytosis pret04145   Phagosome pret04148   Efferocytosis pret05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pret00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103481258    04145 Phagosome     103481258    04137 Mitophagy - animal     103481258    04148 Efferocytosis     103481258  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103481258  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pret04131]     103481258   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pret04147]     103481258    04031 GTP-binding proteins [BR:pret04031]     103481258 Membrane trafficking [BR:pret04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     103481258  Endosome - Lysosome transport     103481258 Exosome [BR:pret04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103481258   Exosomal proteins of other body fluids (saliva and urine)    103481258   Exosomal proteins of colorectal cancer cells    103481258   Exosomal proteins of bladder cancer cells    103481258 GTP-binding proteins [BR:pret04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     103481258 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 Gtr1_RagA GTP_EFTU RsgA_GTPase AAA_16 BrnT_toxin Motif Other DBs NCBI-GeneID:  103481258 NCBI-ProteinID:  XP_008434852 LinkDB All DBs Position LG19:5562394..5567893 Genome browser AA seq 181 aa AA seqDB search MAGRGGGANRPNGAAAANKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFL TQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFTRAKNWVKEL QRQASPNIVIALAGNKADIADKRAVEFQEAQTYADDNSLLFMETSAKTAMNVNEIFMAIG K NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggctgggcgcggcggtggagcaaatcggcctaatggtgctgcggcggcaaacaaaatc tgccagtttaagctggtgctactgggggagtcggccgtgggcaagtccagcttagtgctg cgcttygttaaaggccagttccacgaattccaggagagcacaatcggagctgcgttcctc actcagacggtctgtctggacgacaccactgtgaagtttgagatttgggacacagcgggt caggagcggtaccacagcctcgccccgatgtactacagaggcgctcaggcagccatcgtg gtttacgacatcaccaacacagacacttttacacgtgcraaaaactgggtgaaggagctt cagaggcaggccagccccaacatcgtgatcgctctggcaggcaacaaggcggacatcgct gacaagagagcrgtggagtttcaggaggcgcaaacatacgctgacgacaatagtctgctc ttcatggaaacttcagccaagactgcgatgaatgtcaatgaaatwtttatggccatcggt aagtag

DBGET integrated database retrieval system