Poecilia reticulata (guppy): 19590707 Help Entry 19590707          CDS       T05149                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism pret  Poecilia reticulata (guppy) Pathway pret00190   Oxidative phosphorylation pret01100   Metabolic pathways Module pret_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:pret00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     19590707 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:pret03029]     19590707 (ND4L) Enzymes [BR:pret01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      19590707 (ND4L) Mitochondrial biogenesis [BR:pret03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     19590707 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  19590707 NCBI-ProteinID:  YP_009037670 UniProt:  A0A023ULU5 LinkDB All DBs Position MT:10058..10354 Genome browser AA seq 98 aa AA seqDB search MTPAHFAFSSAFMLGLAGLAFHRTHFISALLCLEGLMLSLFIALSLWTLQFDSMNSASMP MILLAFSACEAGTGLALLVATTRTHSTNRLKNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacccctgctcactttgcattttcatcagctttcatactaggcctagccggccttgcc ttccaccgaacccattttatttcagccctattatgtttagagggattaatactctcttta tttattgcattatccctatgaactcttcaatttgactcaataaattctgcatccatacct atgattctcctggccttttccgcctgcgaagccggcacaggcttagccctcttagtagcc accactcgcactcacagcactaatcgacttaaaaacctaaatctcctacaatgctaa

DBGET integrated database retrieval system