Pseudomonas rhizosphaerae: LT40_00515 Help Entry LT40_00515        CDS       T03339                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism prh  Pseudomonas rhizosphaerae Brite KEGG Orthology (KO) [BR:prh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:prh03036]     LT40_00515 Chromosome and associated proteins [BR:prh03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     LT40_00515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ACCA_BT NRBF2 YabA Motif Other DBs NCBI-ProteinID:  AIS15967 UniProt:  A0A089YNR3 LinkDB All DBs Position 111275..111553 Genome browser AA seq 92 aa AA seqDB search MRSPYWLFLVLLLLLGGLQYRLWVGNGSLKQVAELKQQIAEQHAENERLLERNRVMDAEV LELKKGMETVEERARHELGMVKEGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtccttattggttgtttctcgtcttgcttctgctcctgggtggtttgcagtac cgcctgtgggtcggaaacggaagtctcaagcaggtagccgagctgaaacagcagatcgcc gaacagcacgccgagaacgaacggctgctggaacgcaatcgcgtgatggacgctgaagta ctcgaattgaaaaagggcatggagaccgtcgaagagcgcgctcgccatgaactgggcatg gtcaaggagggtgaaaccctctaccagctggcccaatga

DBGET integrated database retrieval system