Pseudomonas rhizosphaerae: LT40_00720 Help Entry LT40_00720        CDS       T03339                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism prh  Pseudomonas rhizosphaerae Pathway prh01100   Metabolic pathways prh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LT40_00720    00074 Mycolic acid biosynthesis     LT40_00720   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LT40_00720 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AIS16005 UniProt:  A0A089YQN6 LinkDB All DBs Position 152079..152315 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKAEEVNNTSSFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaagatcgtcgccgagcaactgggcgtcaaagcg gaggaggtcaacaacacttcttccttcgttgaagatctgggtgccgattccctggacacc gttgagctggtgatggctctggaagaggaattcgaaaccgagattcctgacgaagaagcc gagaagatcaccactgttcaagctgccatcgattacgtcactgcccaccaggcgtaa

DBGET integrated database retrieval system