Pseudomonas rhizosphaerae: LT40_10910 Help Entry LT40_10910        CDS       T03339                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism prh  Pseudomonas rhizosphaerae Pathway prh01100   Metabolic pathways prh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LT40_10910    00074 Mycolic acid biosynthesis     LT40_10910   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LT40_10910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AIS17869 UniProt:  A0A089YQK3 LinkDB All DBs Position complement(2398112..2398363) Genome browser AA seq 83 aa AA seqDB search MTETTTVLQELTELFRDLFDDESLVLNDDTTADQVEGWDSQMHVMLIVAAEQRFGIKFRT AELESLRNVGQFIQLIDSKRSGS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgactgagaccaccaccgtattgcaggaactgaccgagctgttccgtgacctgttcgac gacgaaagcctggtgctgaacgacgacaccacggccgaccaggtcgagggctgggacagc cagatgcacgtgatgctgatcgtcgccgcggagcagcgcttcggcatcaagttccgcacg gcggagctggagtcgttgcgcaacgttggccagttcatccagcttatcgacagcaaacgt tccgggagttga

DBGET integrated database retrieval system