KEGG   Pseudomonas rhizophila: CRX69_15000
Entry
CRX69_15000       CDS       T09779                                 
Name
(GenBank) Fe3+/spermidine/putrescine ABC transporter ATP-binding protein
  KO
K02052  putative spermidine/putrescine transport system ATP-binding protein
Organism
prhz  Pseudomonas rhizophila
Pathway
prhz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:prhz00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CRX69_15000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:prhz02000]
    CRX69_15000
Transporters [BR:prhz02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putative spermidine/putrescine transporter
    CRX69_15000
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_25 AAA_21 AAA_22 SMC_N AAA Rad17 ABC_ATPase ATP-synt_ab AAA_30 AAA_16 nSTAND3 AAA_19 NB-ARC ORC-CDC6-like AAA_28
Other DBs
NCBI-ProteinID: AVU76433
UniProt: A0ABM6UFY5
LinkDB
Position
complement(3295479..3296504)
AA seq 341 aa
MAFVQLEGLGKRYGAIDAVVDTHLSVEKGEFVSLLGPSGCGKTTTLQMIAGFVEVSSGRI
LLDGRDITHAKPASRGLGVVFQSYALFPHMTVKDNVAFGLRMRKVPGAELQQRVDRVLKL
VRLDQHAERYPRELSGGQRQRVALARALVIEPPVLLLDEPLSNLDANLREEMQYEIRRIQ
REVGITTLMVTHDQSEALSISDRVVVMQAGRITQIDAPYTLYEHPRTEFISGFVGKANLL
PGERDGQGNVQACSQGHGPLVLSLRPEKIDLCQAGSGRLQGVIVSRFFLGSQWLYGVSTN
LGELSVVRRNDGCAPMTEGTAVGLDWDPALLRVLSVDEVPA
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggcttttgtgcaacttgaaggacttggcaaacgttacggcgccatcgatgccgtggtg
gacacccatctctcggtggaaaaaggcgaattcgtctcgctgctgggcccctccggctgc
ggcaaaaccaccactttgcaaatgatcgccggcttcgtcgaagtcagcagtgggcgcatc
ctgctggacggtcgcgatatcacccatgccaagcccgccagtcggggcctgggcgtcgtg
ttccaaagctatgcgctgttcccccacatgaccgtcaaggacaacgtcgctttcggcctg
cgcatgcgcaaagtgcccggcgccgagctgcaacaacgggtggatcgggtgctgaagctg
gtgcgtctggaccagcacgccgagcgctacccgcgggaactctcgggcggccagcgccag
cgcgtggcactggcccgggcgctggtgatcgaaccaccagtgctgctgctcgacgaaccg
ctgtccaatctcgacgccaacctgcgcgaggagatgcagtacgaaatccgccgcattcag
cgggaagtcggcatcaccacattgatggtgacccacgaccaatccgaagcactgtccatc
agtgaccgagtcgtggtgatgcaggccgggcgaatcactcagatcgacgcgccgtacacc
ctctacgaacacccgcgcaccgagttcatttccggcttcgtcggcaaagccaacctgctg
cccggcgagcgcgacggccagggcaatgttcaagcttgcagccagggccacggcccactg
gtcttgagcctgcgtccagagaaaatcgatctgtgccaagccggctcgggtcggttgcaa
ggcgtcatcgtcagccgcttctttctcggcagccaatggctgtacggcgtctcgaccaac
ctgggcgagctcagcgtggtgcgccgcaacgacggctgcgcgccgatgaccgaaggcacg
gcggtaggtcttgactgggatccggcgctgctgcgggtgctgagcgtggacgaggtgccg
gcatga

DBGET integrated database retrieval system