Paenibacillus riograndensis: PRIO_0129 Help Entry PRIO_0129         CDS       T03849                                  Name (GenBank) putative membrane protein   KO K06317   inhibitor of the pro-sigma K processing machinery Organism pri  Paenibacillus riograndensis Brite KEGG Orthology (KO) [BR:pri00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     PRIO_0129 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BofA DUF2784 Motif Other DBs NCBI-ProteinID:  CQR51305 UniProt:  A0A0E4CU06 LinkDB All DBs Position I:134719..134985 Genome browser AA seq 88 aa AA seqDB search MLRMAALAVLVLSGLLLLLIVFKKKLGWAWLSLFGTHLLLAALGIYIVNFSGLLTDIYIP LNPATIGAVTVLGLPGVLMLMGLKLTLF NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgttaagaatggccgcactggcagtgctggttctatccggacttttattactgcttatt gttttcaaaaaaaaattgggctgggcttggctcagcctcttcggtacacatctccttctg gctgcgctgggcatttatatagtgaatttttcgggcttgctaacggatatatatattccc ctgaaccctgccactataggtgctgtaacggttcttggtcttccgggagtgctgatgctt atgggtttgaaattaactttgttttaa

DBGET integrated database retrieval system