Paenibacillus riograndensis: PRIO_2933 Help Entry PRIO_2933         CDS       T03849                                  Name (GenBank) hypothetical protein   KO K03060   DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] Organism pri  Paenibacillus riograndensis Pathway pri03020   RNA polymerase Brite KEGG Orthology (KO) [BR:pri00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PRIO_2933  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pri03021]     PRIO_2933    03400 DNA repair and recombination proteins [BR:pri03400]     PRIO_2933 Enzymes [BR:pri01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.6  DNA-directed RNA polymerase      PRIO_2933 Transcription machinery [BR:pri03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      PRIO_2933 DNA repair and recombination proteins [BR:pri03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       PRIO_2933 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-ProteinID:  CQR55336 UniProt:  A0A0E4CWJ4 LinkDB All DBs Position I:3494323..3494523 Genome browser AA seq 66 aa AA seqDB search MLYPSIDEMMTKVDSKYSLVVAAARRARVLREGGKTEIKAPRSHKFVGVALEEVFEDRIT VTRGEE NT seq 201 nt NT seq  +upstreamnt  +downstreamnt gtgctatatccatccattgacgaaatgatgactaaagttgacagcaagtattccctggtg gttgctgcagcccgccgggcgagagtgctccgggaaggcggcaagaccgagatcaaagct ccaagatcacacaagttcgttggtgttgccctggaggaagtttttgaagaccgtattacg gtaacccgcggcgaagagtag

DBGET integrated database retrieval system