Paenibacillus riograndensis: PRIO_4485 Help Entry PRIO_4485         CDS       T03849                                  Name (GenBank) DNA-binding protein HU 1   KO K03530   DNA-binding protein HU-beta Organism pri  Paenibacillus riograndensis Brite KEGG Orthology (KO) [BR:pri00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pri03032]     PRIO_4485    03036 Chromosome and associated proteins [BR:pri03036]     PRIO_4485    03400 DNA repair and recombination proteins [BR:pri03400]     PRIO_4485 DNA replication proteins [BR:pri03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PRIO_4485 Chromosome and associated proteins [BR:pri03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PRIO_4485 DNA repair and recombination proteins [BR:pri03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PRIO_4485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  CQR56887 UniProt:  A0A0E4HFQ1 LinkDB All DBs Position I:complement(5203784..5204056) Genome browser AA seq 90 aa AA seqDB search MNKSDLINVVTEATELPKKDATKAVDAVFEAITGALQNGDKVQLVGFGNFEVRERSARKG RNPQTGEEIEIPSSKVPAFKPGKALKDGIK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaatcagatttgatcaacgtggtgacagaagcaactgaacttcccaagaaagat gctactaaagcggtagatgccgttttcgaagcgatcacaggtgctctgcaaaacggagat aaagttcagctggtaggattcggaaactttgaagtgcgtgaacgttccgcacgcaaaggc cgcaacccgcagactggtgaagaaatcgaaattccttcgagcaaggtaccggcgttcaaa ccgggtaaagctctgaaagacggaatcaaatag

DBGET integrated database retrieval system