KEGG   Paenibacillus riograndensis: PRIO_6314
Entry
PRIO_6314         CDS       T03849                                 
Symbol
atpD
Name
(GenBank) ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
pri  Paenibacillus riograndensis
Pathway
pri00190  Oxidative phosphorylation
pri01100  Metabolic pathways
Module
pri_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:pri00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PRIO_6314 (atpD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:pri00194]
    PRIO_6314 (atpD)
Enzymes [BR:pri01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     PRIO_6314 (atpD)
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     PRIO_6314 (atpD)
Photosynthesis proteins [BR:pri00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   PRIO_6314 (atpD)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_VA_C ATP-synt_ab_N T3SS_ATPase_C RsgA_GTPase AAA_19 TrwB_AAD_bind AAA_16 AAA_7 AAA_22 AAA ATPase ABC_tran DUF1858
Other DBs
NCBI-ProteinID: CQR58661
UniProt: A0A0E4CZJ7
LinkDB
Position
I:complement(7360189..7361586)
AA seq 465 aa
MNKGRVVSIMGPVVDIEFERGQLPEIFNAIKIVTSLANGSTSELTLEVSNHLGDNLVRCI
AMSSTDGLVRGLEALDQGGPISVPVGDATLGRVFNVLGNPIDNGAEVVADRNPIHRLAPT
FDELSTQAEILETGIKVIDLLAPYAKGGKIGLFGGAGVGKTVTIQELINNIAQEHGGISV
FAGVGERTREGNDLYHEMTDSGVIKKTAMVFGQMNEPPGARLRVALTGLTMAEYFRDVEG
RDTLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLATEMGQLQERITSTKKGSVTSIQ
AIYVPADDYTDPAPATAFAHLDATTNLERKISEKGIFPAVDPLASSSRILAPEIVGEEHY
NVAQGVKQLLQRYTELQDIIAILGMDELSEEDKVIVARARKVERFLSQPFHVAEQFTGFK
GKYVPIKETVRSFKEILEGKHDDLPEAAFLFVGTIEEAVEKAKSM
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaacaaaggacgcgttgtaagcattatgggtccggttgtcgatattgaatttgaacgc
ggccagttgcccgagattttcaacgctatcaagattgtaaccagcctggcaaacggcagc
accagtgagctgaccctggaggtttccaatcacctgggggacaatctggtgcgttgtatc
gccatgtcttccacagacggtctggtccgcggcttggaagcacttgaccagggcggaccg
atctcggttccggttggcgatgcaactcttggacgtgtattcaacgtgctgggcaatccg
attgataacggtgctgaagttgttgcggacagaaatccgattcaccgcctggctccgaca
tttgatgaattgtcgacacaagcggagattctggaaaccgggatcaaggttatcgacctt
ctcgccccatacgccaaaggcggtaaaatcggccttttcggcggtgccggtgtaggaaaa
accgtaacgattcaggaactgatcaacaacatcgcacaggaacatggcgggatctccgta
ttcgcaggtgttggcgaacggacccgtgaaggtaatgacctctatcatgaaatgaccgat
tccggcgttatcaagaaaacggccatggtattcggacaaatgaatgagccgccgggcgca
cgccttcgtgtagccctgaccggactgaccatggcggagtatttccgcgatgtggagggc
cgcgacacgctgctctttatcgataacatattccgctttacccaagcgggttccgaagta
tccgcactgcttggccgcatgccttctgccgtaggttaccagcctacactggcaacagaa
atgggccagctgcaagagcgcatcacttccaccaaaaaaggttcggttacctcgatccag
gctatttacgtgccggcggatgactacactgaccctgctccggcaacggcatttgcccac
ttggatgcaactaccaacctggagcgtaagatttccgaaaaaggtatcttccctgccgtt
gacccgctggcttccagctcacgtatcctcgctccggaaattgtcggcgaagagcactac
aacgtggcacagggcgttaagcagctgctgcagcgttataccgagcttcaggacattatt
gccatcctgggtatggatgagctcagtgaagaagataaggtcattgtagcccgtgcccgt
aaggttgaacgcttcctgtcgcagcctttccacgtggccgaacaattcaccggcttcaag
ggcaaatacgtgccaatcaaagaaaccgtacgcagcttcaaagagattctggaaggcaag
catgatgatcttccggaagcagcgttcctgtttgtcggaacgatcgaagaagcggttgaa
aaagcgaaatcgatgtaa

DBGET integrated database retrieval system