Pedobacter riviphilus: H9N25_18085 Help Entry H9N25_18085       CDS       T08657                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism prk  Pedobacter riviphilus Pathway prk01100   Metabolic pathways prk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H9N25_18085    00074 Mycolic acid biosynthesis     H9N25_18085   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H9N25_18085 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QNR83830 UniProt:  A0ABX6TFW8 LinkDB All DBs Position 4414056..4414292 Genome browser AA seq 78 aa AA seqDB search MSDIASRVKAIIVEKLGVDESEVTPEASFTNDLGADSLDTVELIMEFEKEFNVAIPDDQA ETIGTVGQAIAYLEKNVK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgatattgcttcaagagttaaggctattatcgtagaaaaactaggtgttgacgaa agcgaagttacgccagaggcttcattcaccaacgatttaggtgcagattctttagatacc gtagaattgattatggaatttgaaaaagaattcaatgtagctattcctgatgatcaggct gaaaccatcggtacagttggccaagcgattgcttatttggaaaaaaacgttaaatag

DBGET integrated database retrieval system