KEGG   Cutibacterium modestum: BCB70_11190
Entry
BCB70_11190       CDS       T04515                                 
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
prl  Cutibacterium modestum
Pathway
prl00770  Pantothenate and CoA biosynthesis
prl01100  Metabolic pathways
prl01240  Biosynthesis of cofactors
Module
prl_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:prl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BCB70_11190
Enzymes [BR:prl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     BCB70_11190
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig Nup54_57_C
Other DBs
NCBI-ProteinID: AOH46372
LinkDB
Position
2374377..2374853
AA seq 158 aa
MKAVFSGSFDPITLGHVDIVTRAAELVDEIVVGVAVNSAKNGIFSMDERVAFVKDAVADI
PGVEVALVDGLLVDFCTDKGADAIIRGLRFGGDFDYELQMAHLNKAMSGIETILLPAGRE
FGTISSSMIRSAACNGGNVSEFVPGMVDIALRERFPHQ
NT seq 477 nt   +upstreamnt  +downstreamnt
gtgaaagcagttttctcaggatcattcgatcccatcacacttggccatgttgacatcgtg
acccgagctgccgagctcgtcgacgagatcgttgtcggagtggctgtgaactccgcgaag
aacggcatcttctccatggatgagcgggtagctttcgtcaaggatgcggtcgccgatatc
cccggtgtcgaggtggccctcgttgacggcctgttggtcgatttctgcactgacaagggg
gccgacgccatcatccgtgggctgcgatttggtggcgactttgactacgagctccagatg
gcccacctcaataaggctatgagcggcattgaaaccattttactgccagctggccgtgaa
ttcggaactatcagctcctcgatgattcgctctgctgcctgcaatggcggcaatgtctca
gaattcgttccgggaatggttgatatcgcgttgcgtgagagattcccgcatcagtga

DBGET integrated database retrieval system