Prochlorococcus sp. MIT 0801: EW15_2131 Help Entry EW15_2131         CDS       T03316                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism prm  Prochlorococcus sp. MIT 0801 Pathway prm01100   Metabolic pathways prm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:prm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EW15_2131    00074 Mycolic acid biosynthesis     EW15_2131   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EW15_2131 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AIQ98223 UniProt:  A0A089PJ67 LinkDB All DBs Position 1753688..1753930 Genome browser AA seq 80 aa AA seqDB search MSQEAILEKVRSIVAEQLSVEAGEVKPDSNFQNDLGADSLDTVELVMALEEAFDIEIPDE AAEGIATVGDAVNYIEEKQS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcccaggaagcaatccttgaaaaagttcgttctatcgtcgcagaacaacttagtgtt gaagctggtgaagttaaaccggattcaaatttccaaaacgatctcggtgcagactctctc gacactgtcgagctagtgatggctctggaagaggcgtttgacatagagatccctgacgaa gctgcagaaggcattgccactgtgggggatgcagtcaattacatcgaagaaaaacagtct tga

DBGET integrated database retrieval system