Protaetiibacter sp. SSC-01: H4J02_13630 Help Entry H4J02_13630       CDS       T09940                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism proa  Protaetiibacter sp. SSC-01 Brite KEGG Orthology (KO) [BR:proa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:proa03032]     H4J02_13630    03036 Chromosome and associated proteins [BR:proa03036]     H4J02_13630    03400 DNA repair and recombination proteins [BR:proa03400]     H4J02_13630 DNA replication proteins [BR:proa03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     H4J02_13630 Chromosome and associated proteins [BR:proa03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     H4J02_13630 DNA repair and recombination proteins [BR:proa03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       H4J02_13630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 Motif Other DBs NCBI-ProteinID:  QNO37440 UniProt:  A0A7G9XPY2 LinkDB All DBs Position complement(2913378..2913662) Genome browser AA seq 94 aa AA seqDB search MADTLNKSDLVAAIAAETGESQAAVNKVVDAFFSVVAKQVGGGTKVSIPGWLSFEKTHRA ARAGRNPATGETIQIAASNGVKVSAGSKLKAAVK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctgacaccctcaacaagagcgacctcgtcgccgcgatcgcggccgagaccggcgag agccaggcggccgtcaacaaggtcgtcgacgcgttcttctccgtcgtcgccaagcaggtc ggcggcggcacgaaggtcagcatccccggctggctctcgttcgagaagacccaccgcgcc gctcgtgcgggccgcaaccccgcgaccggcgagaccatccagatcgcggcgtccaacggc gtcaaggtctcggcgggcagcaagctcaaggccgccgtcaagtaa

DBGET integrated database retrieval system