Phodopus roborovskii (desert hamster): 127213106 Help Entry 127213106         CDS       T08852                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04014   Ras signaling pathway prob04015   Rap1 signaling pathway prob04022   cGMP-PKG signaling pathway prob04024   cAMP signaling pathway prob04062   Chemokine signaling pathway prob04071   Sphingolipid signaling pathway prob04072   Phospholipase D signaling pathway prob04081   Hormone signaling prob04144   Endocytosis prob04150   mTOR signaling pathway prob04270   Vascular smooth muscle contraction prob04310   Wnt signaling pathway prob04350   TGF-beta signaling pathway prob04360   Axon guidance prob04510   Focal adhesion prob04520   Adherens junction prob04530   Tight junction prob04611   Platelet activation prob04621   NOD-like receptor signaling pathway prob04625   C-type lectin receptor signaling pathway prob04660   T cell receptor signaling pathway prob04670   Leukocyte transendothelial migration prob04722   Neurotrophin signaling pathway prob04810   Regulation of actin cytoskeleton prob04921   Oxytocin signaling pathway prob04928   Parathyroid hormone synthesis, secretion and action prob04972   Pancreatic secretion prob05100   Bacterial invasion of epithelial cells prob05132   Salmonella infection prob05133   Pertussis prob05135   Yersinia infection prob05152   Tuberculosis prob05163   Human cytomegalovirus infection prob05200   Pathways in cancer prob05203   Viral carcinogenesis prob05205   Proteoglycans in cancer prob05206   MicroRNAs in cancer prob05210   Colorectal cancer prob05417   Lipid and atherosclerosis prob05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     127213106    04015 Rap1 signaling pathway     127213106    04310 Wnt signaling pathway     127213106    04350 TGF-beta signaling pathway     127213106    04072 Phospholipase D signaling pathway     127213106    04071 Sphingolipid signaling pathway     127213106    04024 cAMP signaling pathway     127213106    04022 cGMP-PKG signaling pathway     127213106    04150 mTOR signaling pathway     127213106   09133 Signaling molecules and interaction    04081 Hormone signaling     127213106  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127213106   09144 Cellular community - eukaryotes    04510 Focal adhesion     127213106    04520 Adherens junction     127213106    04530 Tight junction     127213106   09142 Cell motility    04810 Regulation of actin cytoskeleton     127213106  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     127213106    04621 NOD-like receptor signaling pathway     127213106    04625 C-type lectin receptor signaling pathway     127213106    04660 T cell receptor signaling pathway     127213106    04670 Leukocyte transendothelial migration     127213106    04062 Chemokine signaling pathway     127213106   09152 Endocrine system    04921 Oxytocin signaling pathway     127213106    04928 Parathyroid hormone synthesis, secretion and action     127213106   09153 Circulatory system    04270 Vascular smooth muscle contraction     127213106   09154 Digestive system    04972 Pancreatic secretion     127213106   09156 Nervous system    04722 Neurotrophin signaling pathway     127213106   09158 Development and regeneration    04360 Axon guidance     127213106  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127213106    05206 MicroRNAs in cancer     127213106    05205 Proteoglycans in cancer     127213106    05203 Viral carcinogenesis     127213106   09162 Cancer: specific types    05210 Colorectal cancer     127213106   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     127213106   09171 Infectious disease: bacterial    05132 Salmonella infection     127213106    05135 Yersinia infection     127213106    05133 Pertussis     127213106    05152 Tuberculosis     127213106    05100 Bacterial invasion of epithelial cells     127213106   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127213106    05418 Fluid shear stress and atherosclerosis     127213106  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:prob04131]     127213106   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:prob04147]     127213106    04031 GTP-binding proteins [BR:prob04031]     127213106 Membrane trafficking [BR:prob04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     127213106 Exosome [BR:prob04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127213106   Exosomal proteins of other body fluids (saliva and urine)    127213106   Exosomal proteins of colorectal cancer cells    127213106   Exosomal proteins of bladder cancer cells    127213106 GTP-binding proteins [BR:prob04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     127213106 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA VASP_tetra SRPRB Motif Other DBs NCBI-GeneID:  127213106 NCBI-ProteinID:  XP_051029310 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENDVADIEVDGKQVELALWDT AGQEDYDRLRPLSYIDTDVILMCFSIDSPDSLENIPEKWTPEIKHFCPNVPIILVGNQKD LRNDEHTRRELAKMKQEPIKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARCGKKKSGCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgctatcaggaagaaacttgtgattgttggtgatggagcttgtggtaagacgtgc ttgctcatagtcttcagcaaggatcaattcccagaggtttatgtgcccacggtgtttgaa aacgatgtggcagatatcgaagtggatggaaagcaggtagagttggctctgtgggataca gctggacaggaagattatgatcgcctgaggcccctctcctatatagacactgatgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact ccagaaatcaagcatttctgtcccaatgtgcccatcatcctggttgggaaccagaaggat cttcggaatgatgagcacacaagacgggaattagccaaaatgaagcaggagccgataaaa cccgaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagagaggtctttgaaatggccacgagagctgctctgcaa gccagatgtgggaagaaaaaatctgggtgcctcattttgtga

DBGET integrated database retrieval system