Phodopus roborovskii (desert hamster): 127216331 Help Entry 127216331         CDS       T08852                                  Symbol Gast Name (RefSeq) gastrin   KO K13768   gastrin Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04081   Hormone signaling prob04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     127216331 (Gast)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     127216331 (Gast)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127216331 (Gast) Cytokines and neuropeptides [BR:prob04052]  Neuropeptides   GPCR binding    127216331 (Gast) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  127216331 NCBI-ProteinID:  XP_051032913 UniProt:  A0AAU9YMG8 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MARLCICVLILVLVLATFSEASWKPHSHLQDASSGPGTSRGLEPHQLDQLHPASPHRRQL GLQSPQHFITDLSKKQRPRMEEEEEAYGWMDFGRRSAEEGDQRN NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggctcgactgtgcatatgcgtgctcatcttggtgctggttctggctaccttctctgaa gcttcttggaagccccactcccatctacaggatgcatcctctggaccagggaccagcagg ggcctggaaccgcaccagctggaccagctgcacccagcctctccccatcgaaggcagctg gggctccagagtcctcaacacttcataacagacctgtccaagaagcagaggccacggatg gaggaagaagaagaggcatatggatggatggactttggccgccgcagtgctgaggaaggg gaccagcgtaactag

DBGET integrated database retrieval system