Phodopus roborovskii (desert hamster): 127216351 Help Entry 127216351         CDS       T08852                                  Symbol Pfn2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04015   Rap1 signaling pathway prob04810   Regulation of actin cytoskeleton prob05014   Amyotrophic lateral sclerosis prob05132   Salmonella infection Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     127216351 (Pfn2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     127216351 (Pfn2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127216351 (Pfn2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     127216351 (Pfn2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:prob04131]     127216351 (Pfn2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:prob04812]     127216351 (Pfn2)    04147 Exosome [BR:prob04147]     127216351 (Pfn2) Membrane trafficking [BR:prob04131]  Others   Actin-binding proteins    Others     127216351 (Pfn2) Cytoskeleton proteins [BR:prob04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      127216351 (Pfn2) Exosome [BR:prob04147]  Exosomal proteins   Proteins found in most exosomes    127216351 (Pfn2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  127216351 NCBI-ProteinID:  XP_051032943 UniProt:  A0AAU9YV38 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaagcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcatcacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggtgcaaagaagtgttcagtgatcagagatagtctatacgtt gatggtgactgcacaatggatatccggacaaagagtcaaggtggggagccaacatacaat gttgctgttggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system