KEGG   Phodopus roborovskii (desert hamster): 127216731
Entry
127216731         CDS       T08852                                 
Name
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
prob  Phodopus roborovskii (desert hamster)
Pathway
prob01521  EGFR tyrosine kinase inhibitor resistance
prob01522  Endocrine resistance
prob01524  Platinum drug resistance
prob04010  MAPK signaling pathway
prob04012  ErbB signaling pathway
prob04014  Ras signaling pathway
prob04015  Rap1 signaling pathway
prob04022  cGMP-PKG signaling pathway
prob04024  cAMP signaling pathway
prob04062  Chemokine signaling pathway
prob04066  HIF-1 signaling pathway
prob04068  FoxO signaling pathway
prob04071  Sphingolipid signaling pathway
prob04072  Phospholipase D signaling pathway
prob04114  Oocyte meiosis
prob04140  Autophagy - animal
prob04148  Efferocytosis
prob04150  mTOR signaling pathway
prob04151  PI3K-Akt signaling pathway
prob04210  Apoptosis
prob04218  Cellular senescence
prob04261  Adrenergic signaling in cardiomyocytes
prob04270  Vascular smooth muscle contraction
prob04350  TGF-beta signaling pathway
prob04360  Axon guidance
prob04370  VEGF signaling pathway
prob04371  Apelin signaling pathway
prob04380  Osteoclast differentiation
prob04510  Focal adhesion
prob04520  Adherens junction
prob04540  Gap junction
prob04550  Signaling pathways regulating pluripotency of stem cells
prob04611  Platelet activation
prob04613  Neutrophil extracellular trap formation
prob04620  Toll-like receptor signaling pathway
prob04621  NOD-like receptor signaling pathway
prob04625  C-type lectin receptor signaling pathway
prob04650  Natural killer cell mediated cytotoxicity
prob04657  IL-17 signaling pathway
prob04658  Th1 and Th2 cell differentiation
prob04659  Th17 cell differentiation
prob04660  T cell receptor signaling pathway
prob04662  B cell receptor signaling pathway
prob04664  Fc epsilon RI signaling pathway
prob04666  Fc gamma R-mediated phagocytosis
prob04668  TNF signaling pathway
prob04713  Circadian entrainment
prob04720  Long-term potentiation
prob04722  Neurotrophin signaling pathway
prob04723  Retrograde endocannabinoid signaling
prob04724  Glutamatergic synapse
prob04725  Cholinergic synapse
prob04726  Serotonergic synapse
prob04730  Long-term depression
prob04810  Regulation of actin cytoskeleton
prob04910  Insulin signaling pathway
prob04912  GnRH signaling pathway
prob04914  Progesterone-mediated oocyte maturation
prob04915  Estrogen signaling pathway
prob04916  Melanogenesis
prob04917  Prolactin signaling pathway
prob04919  Thyroid hormone signaling pathway
prob04921  Oxytocin signaling pathway
prob04926  Relaxin signaling pathway
prob04928  Parathyroid hormone synthesis, secretion and action
prob04929  GnRH secretion
prob04930  Type II diabetes mellitus
prob04933  AGE-RAGE signaling pathway in diabetic complications
prob04934  Cushing syndrome
prob04935  Growth hormone synthesis, secretion and action
prob04960  Aldosterone-regulated sodium reabsorption
prob05010  Alzheimer disease
prob05020  Prion disease
prob05022  Pathways of neurodegeneration - multiple diseases
prob05034  Alcoholism
prob05132  Salmonella infection
prob05133  Pertussis
prob05135  Yersinia infection
prob05140  Leishmaniasis
prob05142  Chagas disease
prob05145  Toxoplasmosis
prob05152  Tuberculosis
prob05160  Hepatitis C
prob05161  Hepatitis B
prob05163  Human cytomegalovirus infection
prob05164  Influenza A
prob05165  Human papillomavirus infection
prob05166  Human T-cell leukemia virus 1 infection
prob05167  Kaposi sarcoma-associated herpesvirus infection
prob05170  Human immunodeficiency virus 1 infection
prob05171  Coronavirus disease - COVID-19
prob05200  Pathways in cancer
prob05203  Viral carcinogenesis
prob05205  Proteoglycans in cancer
prob05206  MicroRNAs in cancer
prob05207  Chemical carcinogenesis - receptor activation
prob05208  Chemical carcinogenesis - reactive oxygen species
prob05210  Colorectal cancer
prob05211  Renal cell carcinoma
prob05212  Pancreatic cancer
prob05213  Endometrial cancer
prob05214  Glioma
prob05215  Prostate cancer
prob05216  Thyroid cancer
prob05218  Melanoma
prob05219  Bladder cancer
prob05220  Chronic myeloid leukemia
prob05221  Acute myeloid leukemia
prob05223  Non-small cell lung cancer
prob05224  Breast cancer
prob05225  Hepatocellular carcinoma
prob05226  Gastric cancer
prob05230  Central carbon metabolism in cancer
prob05231  Choline metabolism in cancer
prob05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
prob05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:prob00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    127216731
   04012 ErbB signaling pathway
    127216731
   04014 Ras signaling pathway
    127216731
   04015 Rap1 signaling pathway
    127216731
   04350 TGF-beta signaling pathway
    127216731
   04370 VEGF signaling pathway
    127216731
   04371 Apelin signaling pathway
    127216731
   04668 TNF signaling pathway
    127216731
   04066 HIF-1 signaling pathway
    127216731
   04068 FoxO signaling pathway
    127216731
   04072 Phospholipase D signaling pathway
    127216731
   04071 Sphingolipid signaling pathway
    127216731
   04024 cAMP signaling pathway
    127216731
   04022 cGMP-PKG signaling pathway
    127216731
   04151 PI3K-Akt signaling pathway
    127216731
   04150 mTOR signaling pathway
    127216731
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    127216731
   04148 Efferocytosis
    127216731
  09143 Cell growth and death
   04114 Oocyte meiosis
    127216731
   04210 Apoptosis
    127216731
   04218 Cellular senescence
    127216731
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    127216731
   04520 Adherens junction
    127216731
   04540 Gap junction
    127216731
   04550 Signaling pathways regulating pluripotency of stem cells
    127216731
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    127216731
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    127216731
   04613 Neutrophil extracellular trap formation
    127216731
   04620 Toll-like receptor signaling pathway
    127216731
   04621 NOD-like receptor signaling pathway
    127216731
   04625 C-type lectin receptor signaling pathway
    127216731
   04650 Natural killer cell mediated cytotoxicity
    127216731
   04660 T cell receptor signaling pathway
    127216731
   04658 Th1 and Th2 cell differentiation
    127216731
   04659 Th17 cell differentiation
    127216731
   04657 IL-17 signaling pathway
    127216731
   04662 B cell receptor signaling pathway
    127216731
   04664 Fc epsilon RI signaling pathway
    127216731
   04666 Fc gamma R-mediated phagocytosis
    127216731
   04062 Chemokine signaling pathway
    127216731
  09152 Endocrine system
   04910 Insulin signaling pathway
    127216731
   04929 GnRH secretion
    127216731
   04912 GnRH signaling pathway
    127216731
   04915 Estrogen signaling pathway
    127216731
   04914 Progesterone-mediated oocyte maturation
    127216731
   04917 Prolactin signaling pathway
    127216731
   04921 Oxytocin signaling pathway
    127216731
   04926 Relaxin signaling pathway
    127216731
   04935 Growth hormone synthesis, secretion and action
    127216731
   04919 Thyroid hormone signaling pathway
    127216731
   04928 Parathyroid hormone synthesis, secretion and action
    127216731
   04916 Melanogenesis
    127216731
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    127216731
   04270 Vascular smooth muscle contraction
    127216731
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    127216731
  09156 Nervous system
   04724 Glutamatergic synapse
    127216731
   04725 Cholinergic synapse
    127216731
   04726 Serotonergic synapse
    127216731
   04720 Long-term potentiation
    127216731
   04730 Long-term depression
    127216731
   04723 Retrograde endocannabinoid signaling
    127216731
   04722 Neurotrophin signaling pathway
    127216731
  09158 Development and regeneration
   04360 Axon guidance
    127216731
   04380 Osteoclast differentiation
    127216731
  09159 Environmental adaptation
   04713 Circadian entrainment
    127216731
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    127216731
   05206 MicroRNAs in cancer
    127216731
   05205 Proteoglycans in cancer
    127216731
   05207 Chemical carcinogenesis - receptor activation
    127216731
   05208 Chemical carcinogenesis - reactive oxygen species
    127216731
   05203 Viral carcinogenesis
    127216731
   05230 Central carbon metabolism in cancer
    127216731
   05231 Choline metabolism in cancer
    127216731
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    127216731
  09162 Cancer: specific types
   05210 Colorectal cancer
    127216731
   05212 Pancreatic cancer
    127216731
   05225 Hepatocellular carcinoma
    127216731
   05226 Gastric cancer
    127216731
   05214 Glioma
    127216731
   05216 Thyroid cancer
    127216731
   05221 Acute myeloid leukemia
    127216731
   05220 Chronic myeloid leukemia
    127216731
   05218 Melanoma
    127216731
   05211 Renal cell carcinoma
    127216731
   05219 Bladder cancer
    127216731
   05215 Prostate cancer
    127216731
   05213 Endometrial cancer
    127216731
   05224 Breast cancer
    127216731
   05223 Non-small cell lung cancer
    127216731
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    127216731
   05170 Human immunodeficiency virus 1 infection
    127216731
   05161 Hepatitis B
    127216731
   05160 Hepatitis C
    127216731
   05171 Coronavirus disease - COVID-19
    127216731
   05164 Influenza A
    127216731
   05163 Human cytomegalovirus infection
    127216731
   05167 Kaposi sarcoma-associated herpesvirus infection
    127216731
   05165 Human papillomavirus infection
    127216731
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    127216731
   05135 Yersinia infection
    127216731
   05133 Pertussis
    127216731
   05152 Tuberculosis
    127216731
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    127216731
   05140 Leishmaniasis
    127216731
   05142 Chagas disease
    127216731
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    127216731
   05020 Prion disease
    127216731
   05022 Pathways of neurodegeneration - multiple diseases
    127216731
  09165 Substance dependence
   05034 Alcoholism
    127216731
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    127216731
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    127216731
   04933 AGE-RAGE signaling pathway in diabetic complications
    127216731
   04934 Cushing syndrome
    127216731
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    127216731
   01524 Platinum drug resistance
    127216731
   01522 Endocrine resistance
    127216731
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:prob01001]
    127216731
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:prob03036]
    127216731
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:prob04147]
    127216731
Enzymes [BR:prob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     127216731
Protein kinases [BR:prob01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   127216731
Chromosome and associated proteins [BR:prob03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     127216731
Exosome [BR:prob04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   127216731
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 127216731
NCBI-ProteinID: XP_051033508
LinkDB
Position
Unknown
AA seq 358 aa
MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcccggagatggtccgcgggcaggtgttcgacgtgggg
ccgcgctacaccaacctctcctacatcggagagggcgcctacggcatggtttgctcagct
tacgataatctcaacaaagttcgagttgctatcaagaaaatcagcccttttgagcaccag
acctactgccagagaaccctaagagagataaaaatcttgctgcgtttcagacatgagaat
atcatcggcatcaatgacatcatccgggcaccaaccattgagcaaatgaaagatgtatat
atagtacaggacctcatggagacagatctttacaagctcttgaagacacaacacctcagc
aatgaccatatctgctattttctgtatcagatcctgagaggattaaaatacatccattca
gctaatgttctgcatcgtgacctcaagccttccaacctcctgctgaacaccacttgtgat
ctcaagatctgtgactttggccttgcccgtgttgcagatccggatcatgatcacacaggg
ttcttgacagagtatgtagccacacgttggtacagagctccagaaattatgttgaattcc
aagggttataccaagtccattgacatctggtctgtgggctgcatcctggcagagatgctc
tccaacaggcctatcttccccgggaagcactaccttgaccagttgaatcacatcctgggt
attcttggatctccatcacaggaagatctgaattgtataataaatttaaaagctagaaac
tacttgctttctctcccgcacaaaaataaggtgccatggaacaggctgttcccaaatgct
gactctaaagctctggacttactggataaaatgttgacatttaaccctcacaaaaggatt
gaagttgaacaggctctggcccacccatacctggagcagtattatgacccaagtgatgag
cccattgccgaagcaccattcaagtttgacatggaattggatgacttacctaaggagaag
ctcaaagaactcatttttgaagagactgctagattccagccaggatacagatcttaa

DBGET integrated database retrieval system