Phodopus roborovskii (desert hamster): 127218619 Help Entry 127218619         CDS       T08852                                  Name (RefSeq) histone H3.1-like   KO K11253   histone H3 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04613   Neutrophil extracellular trap formation prob05034   Alcoholism prob05202   Transcriptional misregulation in cancer prob05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:prob00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     127218619  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     127218619   09163 Immune disease    05322 Systemic lupus erythematosus     127218619   09165 Substance dependence    05034 Alcoholism     127218619  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:prob03036]     127218619   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:prob04147]     127218619 Chromosome and associated proteins [BR:prob03036]  Eukaryotic type   Nucleosome assembly factors    Histones     127218619 Exosome [BR:prob04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127218619 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF CBFD_NFYB_HMF CENP-T_C CENP-S YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  127218619 NCBI-ProteinID:  XP_051035577 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLAAKVARKSTQGTGTMKKPHRYHPGTVALREIRRYQKTTE LLIRKLPFQRLVREMAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERS NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcacgcaccaagcagacagcgcgaaagtcgactggaggcaaggctccacggaagcag ctggccgcgaaggtggctcgcaagagtacacagggtactggcaccatgaagaagccacac cgctaccacccgggcacggtggcgcttcgcgagatccgtcgctaccagaagaccactgag ctgctgattcgcaagctgccgttccagcgcttggtgcgggagatggcccaggatttcaag actgacctgcgcttccagagctcggctgtgatggcgcttcaggaggcctgcgaatcctac ctcgtggggctattcgaagacaccaacctgtgcgccatccacgccaagcgggtgaccatc atgccgaaagacatccagctggctcgtcgcattcgcggagaacggtcttaa

DBGET integrated database retrieval system