Phodopus roborovskii (desert hamster): 127219314 Help Entry 127219314         CDS       T08852                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04613   Neutrophil extracellular trap formation prob05034   Alcoholism prob05202   Transcriptional misregulation in cancer prob05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:prob00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     127219314  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     127219314   09163 Immune disease    05322 Systemic lupus erythematosus     127219314   09165 Substance dependence    05034 Alcoholism     127219314  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:prob03036]     127219314   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:prob04147]     127219314 Chromosome and associated proteins [BR:prob03036]  Eukaryotic type   Nucleosome assembly factors    Histones     127219314 Exosome [BR:prob04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127219314 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  127219314 NCBI-ProteinID:  XP_051036699 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagaccgctcggaagtccacgggtggcaaagccccccgcaaacag ctggccaccaaggcagccaggaaaagcgcgccctctaccggcggggtgaagaaacctcac cgctacaggcccgggaccgtggctctaagagagatccgtcgttaccagaagtcgactgag ctgctcatccggaagctgcctttccagaggttggtgagggagatcgcccaggacttcaaa accgacttgaggtttcagagtgcagccattggtgcccttcaggaggccagtgaagcgtac ctggtggggttatttgaagataccaatctgtgtgccatccacgccaagagagtcaccatc atgcccaaagacatccagttggcccgccggatacggggggagagagcttaa

DBGET integrated database retrieval system