Phodopus roborovskii (desert hamster): 127219589 Help Entry 127219589         CDS       T08852                                  Symbol Elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04066   HIF-1 signaling pathway prob04120   Ubiquitin mediated proteolysis prob05170   Human immunodeficiency virus 1 infection prob05200   Pathways in cancer prob05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:prob00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     127219589 (Elob)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     127219589 (Elob)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127219589 (Elob)   09162 Cancer: specific types    05211 Renal cell carcinoma     127219589 (Elob)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     127219589 (Elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:prob04121]     127219589 (Elob)    03400 DNA repair and recombination proteins [BR:prob03400]     127219589 (Elob) Ubiquitin system [BR:prob04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      127219589 (Elob)    Cul5 complex      127219589 (Elob) DNA repair and recombination proteins [BR:prob03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      127219589 (Elob) BRITE hierarchy Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  127219589 NCBI-ProteinID:  XP_051037231 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADDAFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttctcatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagtaccgtgttcgagctgaagcgcatcgtcgagggcatcctcaagcggccgccggat gagcagcggctgtacaaggatgaccagctccttgatgatggaaaaactctgggtgaatgt ggcttcactagccagacagcacggccccaggccccagccacagtgggcctggccttccga gcagatgatgcctttgaagcactgcgcattgagcccttctccagccctccagagcttcca gatgtgatgaagccacaggattccggaggcagtgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system