Phodopus roborovskii (desert hamster): 127219753 Help Entry 127219753         CDS       T08852                                  Name (RefSeq) histone H2B type 3-B   KO K11252   histone H2B Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04613   Neutrophil extracellular trap formation prob05034   Alcoholism prob05203   Viral carcinogenesis prob05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:prob00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     127219753  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     127219753   09163 Immune disease    05322 Systemic lupus erythematosus     127219753   09165 Substance dependence    05034 Alcoholism     127219753  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:prob03036]     127219753   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:prob04147]     127219753 Chromosome and associated proteins [BR:prob03036]  Eukaryotic type   Nucleosome assembly factors    Histones     127219753 Exosome [BR:prob04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127219753 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  127219753 NCBI-ProteinID:  XP_051037478 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPDPSKSAPAPKKGSKKAVTKAQKKDGKKRKRGRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIASEASRLAHYNKRSTITSREVQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgatccgtcaaaatctgctccagcccccaagaagggttccaagaaagctgtcacc aaggctcagaaaaaggatggcaagaaacgcaaacggggccgcaaggagagctactccatc tacgtgtacaaggtgctgaagcaggtgcaccccgacaccggcatctcctccaaagccatg ggcatcatgaactccttcgtcaacgacattttcgagcgcatcgccagtgaggcctcccgc ctggcgcattataacaagcgctcgaccatcacttcccgagaggtgcagacggccgtgcgt ctgctgctgcccggggagctggccaaacatgccgtgtccgagggcactaaggctgtcacc aagtatactagctccaagtga

DBGET integrated database retrieval system