Phodopus roborovskii (desert hamster): 127220167 Help Entry 127220167         CDS       T08852                                  Symbol Pfn4 Name (RefSeq) profilin-4   KO K05759   profilin Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04015   Rap1 signaling pathway prob04810   Regulation of actin cytoskeleton prob05014   Amyotrophic lateral sclerosis prob05132   Salmonella infection Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     127220167 (Pfn4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     127220167 (Pfn4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127220167 (Pfn4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     127220167 (Pfn4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:prob04131]     127220167 (Pfn4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:prob04812]     127220167 (Pfn4)    04147 Exosome [BR:prob04147]     127220167 (Pfn4) Membrane trafficking [BR:prob04131]  Others   Actin-binding proteins    Others     127220167 (Pfn4) Cytoskeleton proteins [BR:prob04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      127220167 (Pfn4) Exosome [BR:prob04147]  Exosomal proteins   Proteins found in most exosomes    127220167 (Pfn4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  127220167 NCBI-ProteinID:  XP_051037856 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLHERSLCVTSPGFSVMPSDVRTLVNGFAKNPLITR REGLYFKEKDYKCVRADDYSLYAKNENTGVIVVKTHQYLLVATYTAGMYPSVCVEATEKL GDYLRKKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagtcacttgcagaacttactgttagataccctgctggggacgaagcacgtggacagt gcagctctcatcaaactccatgaaaggagcctatgtgtgacatctccaggatttagtgta atgccaagtgatgttcgaacacttgtgaatggatttgccaaaaacccactgataaccaga agggaagggttgtatttcaaggaaaaggattacaaatgtgtccgggcagatgactattct ctttatgctaaaaatgagaacaccggtgtgattgttgtgaagacccatcagtatctcctg gtggccacttacactgcaggcatgtatcctagtgtctgtgtggaagccacagagaagctg ggagattatctaagaaaaaaaggaaattaa

DBGET integrated database retrieval system