Phodopus roborovskii (desert hamster): 127220473 Help Entry 127220473         CDS       T08852                                  Name (RefSeq) beta-defensin 38   KO K23125   beta-defensin 1 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob02010   ABC transporters prob05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     127220473  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     127220473  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:prob02000]     127220473    03037 Cilium and associated proteins [BR:prob03037]     127220473 Transporters [BR:prob02000]  Other transporters   Pores ion channels [TC:1]    127220473 Cilium and associated proteins [BR:prob03037]  Motile cilia and associated proteins   Sperm associated proteins    127220473 SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Motif Other DBs NCBI-GeneID:  127220473 NCBI-ProteinID:  XP_051038286 LinkDB All DBs Position Unknown AA seq 64 aa AA seqDB search MKISCFLLLMFCLYFSQIHPVAGYDTIECLDKKAKCQVWKCPWFYVEIGTCFEGRGKCCQ KTRG NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgaagatctcctgctttctgttgttgatgttctgcctatacttctcccagatccaccca gttgctggctatgacacaattgagtgtcttgacaaaaaagcaaagtgtcaagtctggaaa tgcccatggttttatgtggaaattggcacctgttttgaaggaagaggcaagtgctgtcaa aaaacccgtggatga

DBGET integrated database retrieval system