Phodopus roborovskii (desert hamster): 127221295 Help Entry 127221295         CDS       T08852                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04060   Cytokine-cytokine receptor interaction prob04061   Viral protein interaction with cytokine and cytokine receptor prob04062   Chemokine signaling pathway prob04620   Toll-like receptor signaling pathway prob05142   Chagas disease prob05163   Human cytomegalovirus infection prob05323   Rheumatoid arthritis prob05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127221295    04061 Viral protein interaction with cytokine and cytokine receptor     127221295  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127221295    04062 Chemokine signaling pathway     127221295  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     127221295   09174 Infectious disease: parasitic    05142 Chagas disease     127221295   09163 Immune disease    05323 Rheumatoid arthritis     127221295   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127221295  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127221295    00536 Glycosaminoglycan binding proteins [BR:prob00536]     127221295 Cytokines and neuropeptides [BR:prob04052]  Cytokines   Chemokines    127221295 Glycosaminoglycan binding proteins [BR:prob00536]  Heparan sulfate / Heparin   Chemokines    127221295 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  127221295 NCBI-ProteinID:  XP_051039148 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MKVPMAALAVLLCTMALCNEVFSAPYGADTPTSCCFSYGRQVPRKFIADYFETSSLCSEP GVIFLTKRNRQLCADPKETWVQEYITDLELNAGEAARQ NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaggtccccatggctgcccttgctgtccttctctgcaccatggctctctgtaacgaa gtcttctcagcaccatatggtgctgacaccccaacctcctgctgtttctcctatggccgg caggttccccgcaaattcatcgctgactattttgagaccagcagcctctgctctgagcca ggtgtcattttcctaaccaagagaaaccggcagctctgcgctgaccccaaagaaacctgg gtacaagagtatatcactgacctggagctgaatgccggagaggctgcgaggcagtga

DBGET integrated database retrieval system