Phodopus roborovskii (desert hamster): 127221462 Help Entry 127221462         CDS       T08852                                  Symbol Il1b Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism prob  Phodopus roborovskii (desert hamster) Pathway prob01523   Antifolate resistance prob04010   MAPK signaling pathway prob04060   Cytokine-cytokine receptor interaction prob04064   NF-kappa B signaling pathway prob04217   Necroptosis prob04380   Osteoclast differentiation prob04620   Toll-like receptor signaling pathway prob04621   NOD-like receptor signaling pathway prob04623   Cytosolic DNA-sensing pathway prob04625   C-type lectin receptor signaling pathway prob04640   Hematopoietic cell lineage prob04657   IL-17 signaling pathway prob04659   Th17 cell differentiation prob04668   TNF signaling pathway prob04750   Inflammatory mediator regulation of TRP channels prob04932   Non-alcoholic fatty liver disease prob04933   AGE-RAGE signaling pathway in diabetic complications prob04936   Alcoholic liver disease prob04940   Type I diabetes mellitus prob05010   Alzheimer disease prob05020   Prion disease prob05022   Pathways of neurodegeneration - multiple diseases prob05132   Salmonella infection prob05133   Pertussis prob05134   Legionellosis prob05135   Yersinia infection prob05140   Leishmaniasis prob05142   Chagas disease prob05143   African trypanosomiasis prob05144   Malaria prob05146   Amoebiasis prob05152   Tuberculosis prob05162   Measles prob05163   Human cytomegalovirus infection prob05164   Influenza A prob05168   Herpes simplex virus 1 infection prob05171   Coronavirus disease - COVID-19 prob05321   Inflammatory bowel disease prob05323   Rheumatoid arthritis prob05332   Graft-versus-host disease prob05417   Lipid and atherosclerosis prob05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127221462 (Il1b)    04064 NF-kappa B signaling pathway     127221462 (Il1b)    04668 TNF signaling pathway     127221462 (Il1b)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127221462 (Il1b)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     127221462 (Il1b)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     127221462 (Il1b)    04620 Toll-like receptor signaling pathway     127221462 (Il1b)    04621 NOD-like receptor signaling pathway     127221462 (Il1b)    04623 Cytosolic DNA-sensing pathway     127221462 (Il1b)    04625 C-type lectin receptor signaling pathway     127221462 (Il1b)    04659 Th17 cell differentiation     127221462 (Il1b)    04657 IL-17 signaling pathway     127221462 (Il1b)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     127221462 (Il1b)   09158 Development and regeneration    04380 Osteoclast differentiation     127221462 (Il1b)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     127221462 (Il1b)    05164 Influenza A     127221462 (Il1b)    05162 Measles     127221462 (Il1b)    05168 Herpes simplex virus 1 infection     127221462 (Il1b)    05163 Human cytomegalovirus infection     127221462 (Il1b)   09171 Infectious disease: bacterial    05132 Salmonella infection     127221462 (Il1b)    05135 Yersinia infection     127221462 (Il1b)    05133 Pertussis     127221462 (Il1b)    05134 Legionellosis     127221462 (Il1b)    05152 Tuberculosis     127221462 (Il1b)   09174 Infectious disease: parasitic    05146 Amoebiasis     127221462 (Il1b)    05144 Malaria     127221462 (Il1b)    05140 Leishmaniasis     127221462 (Il1b)    05142 Chagas disease     127221462 (Il1b)    05143 African trypanosomiasis     127221462 (Il1b)   09163 Immune disease    05323 Rheumatoid arthritis     127221462 (Il1b)    05321 Inflammatory bowel disease     127221462 (Il1b)    05332 Graft-versus-host disease     127221462 (Il1b)   09164 Neurodegenerative disease    05010 Alzheimer disease     127221462 (Il1b)    05020 Prion disease     127221462 (Il1b)    05022 Pathways of neurodegeneration - multiple diseases     127221462 (Il1b)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127221462 (Il1b)    05418 Fluid shear stress and atherosclerosis     127221462 (Il1b)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     127221462 (Il1b)    04936 Alcoholic liver disease     127221462 (Il1b)    04932 Non-alcoholic fatty liver disease     127221462 (Il1b)    04933 AGE-RAGE signaling pathway in diabetic complications     127221462 (Il1b)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     127221462 (Il1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127221462 (Il1b)    00536 Glycosaminoglycan binding proteins [BR:prob00536]     127221462 (Il1b) Cytokines and neuropeptides [BR:prob04052]  Cytokines   Interleukins    127221462 (Il1b) Glycosaminoglycan binding proteins [BR:prob00536]  Heparan sulfate / Heparin   Cytokines    127221462 (Il1b) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep ZinT Motif Other DBs NCBI-GeneID:  127221462 NCBI-ProteinID:  XP_051039371 UniProt:  A0AAU9Z5R9 LinkDB All DBs Position Unknown AA seq 267 aa AA seqDB search MATVPELNSEMIAFHSDENDLFFEVDGSQKMKCCFQSHDLSYPDESIQLQISKQYLNKSF RQVASVIVAVEKLWGIPVPCPWTFQDEDLRTFFSFIFEEEPIFCDSWDDQLIVADVPIRQ LHCRLRDEQQKCFVLSDPCELKALHLNGQNINQQVVFSMSFVQGETSNNKIPVALGLKGK NLYLSCVMKGDTPTLQLESVDPRQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTS QAEHKPVFLGNNSGQDLVDFTMEFVSS NT seq 804 nt NT seq  +upstreamnt  +downstreamnt atggcaactgttcctgaactcaacagtgaaatgatagctttccacagtgatgaaaatgac ctgttctttgaggttgatgggtcccaaaagatgaagtgctgcttccaaagccatgacctg agctatcccgatgagagcattcagcttcaaatctccaagcagtacctcaacaagagcttt aggcaggtggcgtcggtcatcgtggcagtggagaagctgtggggcatacccgtcccttgc ccgtggaccttccaggatgaggatctgagaaccttcttctccttcatctttgaagaagag cccatcttctgtgactcctgggatgatcagctgatcgtggcagatgttcccattcgacag ctgcactgcaggctccgagatgaacaacagaaatgcttcgtgctgtctgatccctgtgag ctgaaagctctccacctcaatggacagaatataaaccaacaagtggtattctccatgagc tttgtacagggagaaacaagcaacaacaagatacctgtggccttgggcctcaagggaaag aatctgtacctgtcctgtgtgatgaaaggtgacacacccaccctgcagctggagagtgtg gatcccagacaatacccaaagaagaagatggaaaagaggtttgtcttcaataagatagaa gtcaaaaccaaggtggagtttgagtctgcacagttccccaactggtacatcagcacctct caagcagagcataagcccgttttcctgggcaacaacagcggccaggatttagttgacttc accatggaattcgtttcttcctag

DBGET integrated database retrieval system