Phodopus roborovskii (desert hamster): 127223580 Help Entry 127223580         CDS       T08852                                  Name (RefSeq) calmodulin-alpha-like   KO K02183   calmodulin Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04014   Ras signaling pathway prob04015   Rap1 signaling pathway prob04020   Calcium signaling pathway prob04022   cGMP-PKG signaling pathway prob04024   cAMP signaling pathway prob04070   Phosphatidylinositol signaling system prob04114   Oocyte meiosis prob04218   Cellular senescence prob04261   Adrenergic signaling in cardiomyocytes prob04270   Vascular smooth muscle contraction prob04371   Apelin signaling pathway prob04625   C-type lectin receptor signaling pathway prob04713   Circadian entrainment prob04720   Long-term potentiation prob04722   Neurotrophin signaling pathway prob04728   Dopaminergic synapse prob04740   Olfactory transduction prob04744   Phototransduction prob04750   Inflammatory mediator regulation of TRP channels prob04910   Insulin signaling pathway prob04912   GnRH signaling pathway prob04915   Estrogen signaling pathway prob04916   Melanogenesis prob04921   Oxytocin signaling pathway prob04922   Glucagon signaling pathway prob04924   Renin secretion prob04925   Aldosterone synthesis and secretion prob04970   Salivary secretion prob04971   Gastric acid secretion prob05010   Alzheimer disease prob05012   Parkinson disease prob05022   Pathways of neurodegeneration - multiple diseases prob05031   Amphetamine addiction prob05034   Alcoholism prob05133   Pertussis prob05152   Tuberculosis prob05163   Human cytomegalovirus infection prob05167   Kaposi sarcoma-associated herpesvirus infection prob05170   Human immunodeficiency virus 1 infection prob05200   Pathways in cancer prob05214   Glioma prob05417   Lipid and atherosclerosis prob05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     127223580    04015 Rap1 signaling pathway     127223580    04371 Apelin signaling pathway     127223580    04020 Calcium signaling pathway     127223580    04070 Phosphatidylinositol signaling system     127223580    04024 cAMP signaling pathway     127223580    04022 cGMP-PKG signaling pathway     127223580  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     127223580    04218 Cellular senescence     127223580  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127223580   09152 Endocrine system    04910 Insulin signaling pathway     127223580    04922 Glucagon signaling pathway     127223580    04912 GnRH signaling pathway     127223580    04915 Estrogen signaling pathway     127223580    04921 Oxytocin signaling pathway     127223580    04916 Melanogenesis     127223580    04924 Renin secretion     127223580    04925 Aldosterone synthesis and secretion     127223580   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     127223580    04270 Vascular smooth muscle contraction     127223580   09154 Digestive system    04970 Salivary secretion     127223580    04971 Gastric acid secretion     127223580   09156 Nervous system    04728 Dopaminergic synapse     127223580    04720 Long-term potentiation     127223580    04722 Neurotrophin signaling pathway     127223580   09157 Sensory system    04744 Phototransduction     127223580    04740 Olfactory transduction     127223580    04750 Inflammatory mediator regulation of TRP channels     127223580   09159 Environmental adaptation    04713 Circadian entrainment     127223580  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127223580   09162 Cancer: specific types    05214 Glioma     127223580   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     127223580    05163 Human cytomegalovirus infection     127223580    05167 Kaposi sarcoma-associated herpesvirus infection     127223580   09171 Infectious disease: bacterial    05133 Pertussis     127223580    05152 Tuberculosis     127223580   09164 Neurodegenerative disease    05010 Alzheimer disease     127223580    05012 Parkinson disease     127223580    05022 Pathways of neurodegeneration - multiple diseases     127223580   09165 Substance dependence    05031 Amphetamine addiction     127223580    05034 Alcoholism     127223580   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127223580    05418 Fluid shear stress and atherosclerosis     127223580  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:prob01009]     127223580   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:prob04131]     127223580    03036 Chromosome and associated proteins [BR:prob03036]     127223580   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:prob04147]     127223580 Protein phosphatases and associated proteins [BR:prob01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      127223580 Membrane trafficking [BR:prob04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     127223580 Chromosome and associated proteins [BR:prob03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      127223580 Exosome [BR:prob04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    127223580 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 EFhand_Ca_insen EF_EFCAB10_C EH FCaBP_EF-hand SPARC_Ca_bdg Poly_export SPEF2_C Dockerin_1 MecA_N DUF3349 Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  127223580 NCBI-ProteinID:  XP_051042225 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLEQNPTEAELQDMSNEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNL NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggctgaccaactgactgaagagcagattgcagaattcaaagaagccttttcactattc gacaaggatggtgatgggactataacaacaaaggaactgggaactgtgatgaggtctctt gagcagaaccccacagaagcagagctgcaggacatgagtaatgaagttgatgcagatggt aatggcacaattgacttccctgaatttctgacaatgatggcaagaaaaatgaaagacaca gacagtgaagaggagatcagagaagcattccgtgtgtttgataaggatggcaatggctac attagtgcagcagagcttcgccatgtgatgacaaacctctga

DBGET integrated database retrieval system