Phodopus roborovskii (desert hamster): 127224060 Help Entry 127224060         CDS       T08852                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04613   Neutrophil extracellular trap formation prob05034   Alcoholism prob05202   Transcriptional misregulation in cancer prob05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:prob00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     127224060  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     127224060   09163 Immune disease    05322 Systemic lupus erythematosus     127224060   09165 Substance dependence    05034 Alcoholism     127224060  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:prob03036]     127224060   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:prob04147]     127224060 Chromosome and associated proteins [BR:prob03036]  Eukaryotic type   Nucleosome assembly factors    Histones     127224060 Exosome [BR:prob04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127224060 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF CENP-T_C Motif Other DBs NCBI-GeneID:  127224060 NCBI-ProteinID:  XP_051042792 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MAHTKQTVRKSTGGKSPRKQLATKAAHNSAPSTGGVKKPHRYRPATVALHEIRRYQKSTE LLIRKRLVREIAQDFKTDLRFQSVAIGALQEASEAYLVGLFEDTNLCAIHAKGVIIMPKD IQLARRIRGERA NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggctcatacaaagcagactgtccgtaaatccaccggtggtaaatcacccaggaaacaa ctggctacaaaagctgctcacaacagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctgctactgtggcactccatgaaatcagacgctatcagaaatccactgaa cttctgattcgcaagcgtctggtgcgagaaattgctcaggacttcaaaacagatctgcgc ttccagagtgtagctattggtgctttgcaggaggcaagtgaggcctatctggttggcctt tttgaagataccaacctgtgtgctatccatgccaaaggtgtaataattatgccaaaagat atccagctagcacgccgcatacgcggagaacgtgcttaa

DBGET integrated database retrieval system