Phodopus roborovskii (desert hamster): 127224164 Help Entry 127224164         CDS       T08852                                  Symbol Cstb Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism prob  Phodopus roborovskii (desert hamster) Brite KEGG Orthology (KO) [BR:prob00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:prob01002]     127224164 (Cstb)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:prob04147]     127224164 (Cstb) Peptidases and inhibitors [BR:prob01002]  Peptidase inhibitors   Family I25: cystatin family    127224164 (Cstb) Exosome [BR:prob04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    127224164 (Cstb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Dynein_light PhosphMutase Motif Other DBs NCBI-GeneID:  127224164 NCBI-ProteinID:  XP_051042988 UniProt:  A0AAU9ZCV3 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MMCGAPSATQPATAETQEIADKVKSQLEEKENQKFSVFKAISFRQQVVAGINFFIKVDVG DDKFVHLRVFKALPHENKPLTLSSYQTNKEQHDELSFF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgtggcgcgccttccgccacgcagccggctacggccgagacgcaggagatcgcc gacaaggtgaaatcccagctcgaagagaaagaaaatcagaagttctccgtctttaaagcc atctccttcaggcaacaggtggtggctggcatcaacttctttatcaaggttgatgttggt gatgataaatttgtgcacttgagggtgttcaaagcccttccccatgaaaacaagcccttg accctgtcttcctaccagaccaacaaagagcaacatgacgagctgagcttcttctga

DBGET integrated database retrieval system