Phodopus roborovskii (desert hamster): 127224849 Help Entry 127224849         CDS       T08852                                  Name (RefSeq) interferon alpha-12-like   KO K05414   interferon alpha Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04060   Cytokine-cytokine receptor interaction prob04151   PI3K-Akt signaling pathway prob04217   Necroptosis prob04620   Toll-like receptor signaling pathway prob04621   NOD-like receptor signaling pathway prob04622   RIG-I-like receptor signaling pathway prob04623   Cytosolic DNA-sensing pathway prob04630   JAK-STAT signaling pathway prob04650   Natural killer cell mediated cytotoxicity prob04936   Alcoholic liver disease prob05152   Tuberculosis prob05160   Hepatitis C prob05161   Hepatitis B prob05162   Measles prob05163   Human cytomegalovirus infection prob05164   Influenza A prob05165   Human papillomavirus infection prob05167   Kaposi sarcoma-associated herpesvirus infection prob05168   Herpes simplex virus 1 infection prob05169   Epstein-Barr virus infection prob05170   Human immunodeficiency virus 1 infection prob05171   Coronavirus disease - COVID-19 prob05200   Pathways in cancer prob05320   Autoimmune thyroid disease prob05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     127224849    04151 PI3K-Akt signaling pathway     127224849   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127224849  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     127224849  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127224849    04621 NOD-like receptor signaling pathway     127224849    04622 RIG-I-like receptor signaling pathway     127224849    04623 Cytosolic DNA-sensing pathway     127224849    04650 Natural killer cell mediated cytotoxicity     127224849  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127224849   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     127224849    05161 Hepatitis B     127224849    05160 Hepatitis C     127224849    05171 Coronavirus disease - COVID-19     127224849    05164 Influenza A     127224849    05162 Measles     127224849    05168 Herpes simplex virus 1 infection     127224849    05163 Human cytomegalovirus infection     127224849    05167 Kaposi sarcoma-associated herpesvirus infection     127224849    05169 Epstein-Barr virus infection     127224849    05165 Human papillomavirus infection     127224849   09171 Infectious disease: bacterial    05152 Tuberculosis     127224849   09163 Immune disease    05320 Autoimmune thyroid disease     127224849   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127224849   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     127224849  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127224849 Cytokines and neuropeptides [BR:prob04052]  Cytokines   Interferons    127224849 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon RIX1 Motif Other DBs NCBI-GeneID:  127224849 NCBI-ProteinID:  XP_051043957 LinkDB All DBs Position Unknown AA seq 190 aa AA seqDB search MARPCVFLLALVMMNYWSTCSLGCHLPQTHNFRNNGALTLLAQMRRLSPFSCLKDRKDFA FPLEKVDAYHIQKAQAILVLHKLTQQVLILFSSKDSSAAWETALLDTFCTSIHQQLNDLQ ACLMQQVGEQEPPLSQEDSLVAVRKYFHRITVYLREKNHSPCAWEVVRAEVWRALSSSDT LLARFSEEKE NT seq 573 nt NT seq  +upstreamnt  +downstreamnt atggccagaccctgtgttttcctgctggccctggtgatgatgaactactggtcaacctgc tctctgggatgtcacctgcctcagactcataacttcaggaacaatggagccttgacactt ctagcacaaatgaggagactctcccccttctcctgcctgaaggacagaaaagactttgca ttccctctggagaaagtggatgcctatcacatccagaaggctcaagccatccttgtccta cacaagctgacccaacaggtcctcatcctcttcagctcaaaggactcatctgctgcttgg gagacagccctcctagacaccttctgcactagcatccaccagcagctcaatgacctgcaa gcctgtctgatgcagcaggtgggggagcaggaacctcccctgagccaggaagactccctg gtggctgtgaggaaatacttccacaggatcactgtctacctgagagagaagaaccacagc ccctgtgcctgggaggtggtcagagcagaagtctggagagcattgtcttcctcagacacc ttgctggcaagatttagtgaggagaaggagtaa

DBGET integrated database retrieval system