Phodopus roborovskii (desert hamster): 127224952 Help Entry 127224952         CDS       T08852                                  Symbol Jun Name (RefSeq) transcription factor Jun   KO K04448   transcription factor AP-1 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob01522   Endocrine resistance prob04010   MAPK signaling pathway prob04012   ErbB signaling pathway prob04024   cAMP signaling pathway prob04137   Mitophagy - animal prob04210   Apoptosis prob04310   Wnt signaling pathway prob04380   Osteoclast differentiation prob04510   Focal adhesion prob04530   Tight junction prob04620   Toll-like receptor signaling pathway prob04621   NOD-like receptor signaling pathway prob04625   C-type lectin receptor signaling pathway prob04657   IL-17 signaling pathway prob04658   Th1 and Th2 cell differentiation prob04659   Th17 cell differentiation prob04660   T cell receptor signaling pathway prob04662   B cell receptor signaling pathway prob04668   TNF signaling pathway prob04722   Neurotrophin signaling pathway prob04912   GnRH signaling pathway prob04915   Estrogen signaling pathway prob04921   Oxytocin signaling pathway prob04926   Relaxin signaling pathway prob04932   Non-alcoholic fatty liver disease prob04933   AGE-RAGE signaling pathway in diabetic complications prob05030   Cocaine addiction prob05031   Amphetamine addiction prob05132   Salmonella infection prob05133   Pertussis prob05135   Yersinia infection prob05140   Leishmaniasis prob05142   Chagas disease prob05161   Hepatitis B prob05162   Measles prob05166   Human T-cell leukemia virus 1 infection prob05167   Kaposi sarcoma-associated herpesvirus infection prob05169   Epstein-Barr virus infection prob05170   Human immunodeficiency virus 1 infection prob05171   Coronavirus disease - COVID-19 prob05200   Pathways in cancer prob05203   Viral carcinogenesis prob05207   Chemical carcinogenesis - receptor activation prob05208   Chemical carcinogenesis - reactive oxygen species prob05210   Colorectal cancer prob05211   Renal cell carcinoma prob05224   Breast cancer prob05231   Choline metabolism in cancer prob05235   PD-L1 expression and PD-1 checkpoint pathway in cancer prob05321   Inflammatory bowel disease prob05323   Rheumatoid arthritis prob05417   Lipid and atherosclerosis prob05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127224952 (Jun)    04012 ErbB signaling pathway     127224952 (Jun)    04310 Wnt signaling pathway     127224952 (Jun)    04668 TNF signaling pathway     127224952 (Jun)    04024 cAMP signaling pathway     127224952 (Jun)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     127224952 (Jun)   09143 Cell growth and death    04210 Apoptosis     127224952 (Jun)   09144 Cellular community - eukaryotes    04510 Focal adhesion     127224952 (Jun)    04530 Tight junction     127224952 (Jun)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127224952 (Jun)    04621 NOD-like receptor signaling pathway     127224952 (Jun)    04625 C-type lectin receptor signaling pathway     127224952 (Jun)    04660 T cell receptor signaling pathway     127224952 (Jun)    04658 Th1 and Th2 cell differentiation     127224952 (Jun)    04659 Th17 cell differentiation     127224952 (Jun)    04657 IL-17 signaling pathway     127224952 (Jun)    04662 B cell receptor signaling pathway     127224952 (Jun)   09152 Endocrine system    04912 GnRH signaling pathway     127224952 (Jun)    04915 Estrogen signaling pathway     127224952 (Jun)    04921 Oxytocin signaling pathway     127224952 (Jun)    04926 Relaxin signaling pathway     127224952 (Jun)   09156 Nervous system    04722 Neurotrophin signaling pathway     127224952 (Jun)   09158 Development and regeneration    04380 Osteoclast differentiation     127224952 (Jun)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127224952 (Jun)    05207 Chemical carcinogenesis - receptor activation     127224952 (Jun)    05208 Chemical carcinogenesis - reactive oxygen species     127224952 (Jun)    05203 Viral carcinogenesis     127224952 (Jun)    05231 Choline metabolism in cancer     127224952 (Jun)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     127224952 (Jun)   09162 Cancer: specific types    05210 Colorectal cancer     127224952 (Jun)    05211 Renal cell carcinoma     127224952 (Jun)    05224 Breast cancer     127224952 (Jun)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     127224952 (Jun)    05170 Human immunodeficiency virus 1 infection     127224952 (Jun)    05161 Hepatitis B     127224952 (Jun)    05171 Coronavirus disease - COVID-19     127224952 (Jun)    05162 Measles     127224952 (Jun)    05167 Kaposi sarcoma-associated herpesvirus infection     127224952 (Jun)    05169 Epstein-Barr virus infection     127224952 (Jun)   09171 Infectious disease: bacterial    05132 Salmonella infection     127224952 (Jun)    05135 Yersinia infection     127224952 (Jun)    05133 Pertussis     127224952 (Jun)   09174 Infectious disease: parasitic    05140 Leishmaniasis     127224952 (Jun)    05142 Chagas disease     127224952 (Jun)   09163 Immune disease    05323 Rheumatoid arthritis     127224952 (Jun)    05321 Inflammatory bowel disease     127224952 (Jun)   09165 Substance dependence    05030 Cocaine addiction     127224952 (Jun)    05031 Amphetamine addiction     127224952 (Jun)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127224952 (Jun)    05418 Fluid shear stress and atherosclerosis     127224952 (Jun)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     127224952 (Jun)    04933 AGE-RAGE signaling pathway in diabetic complications     127224952 (Jun)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     127224952 (Jun)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:prob03000]     127224952 (Jun) Transcription factors [BR:prob03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     127224952 (Jun) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 ZapB PspA_IM30 Fib_alpha DUF3450 TFIIA FlaC_arch Motif Other DBs NCBI-GeneID:  127224952 NCBI-ProteinID:  XP_051044144 UniProt:  A0AAU9ZCY2 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA LSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctgcag tccgagagcggcgcctacggctacagtaaccctaagatcctgaaacagagcatgaccttg aacctggccgacccggtgggcaatctgaagccgcatctccgcgccaagaactcggacctc ctcacgtcgcccgacgtcgggttgctcaagctggcgtcgcccgagctggagcgcctgatc atccagtccagcaatgggcacatcaccaccacgccaacccccacccagttcttgtgcccc aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa ctgcatagccagaacacactgcccagcgtcacgtcggcggcacaaccggtcagcggtgcg ggcatggtggctccggcggtggcttcggttgcaggcgctggcggcggcggcggctacagc gccagcctgcacagtgagcctccggtctacgccaacctcagcaacttcaacccgggtgcg ctgagcagcggcggcggggcgccctcctacggcgcggccgggctggcctttccgtcgcag ccccagcagcagcagcagccaccccagccgccgcaccacttgccccaacagatcccggtg cagcacccgcggctgcaggccctgaaggaagagccccagaccgtgccagagatgccggga gaaaccccgcccctgtcccccatcgacatggagtctcaggagcggatcaaggcggagagg aagcgcatgaggaaccgcatcgctgcttccaagtgccggaaaaggaagctggagaggatc gcccggctagaggaaaaagtgaaaaccttgaaagcgcaaaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtggctgccaactcatgctaactcagcagttgcaaacgttttga

DBGET integrated database retrieval system