Phodopus roborovskii (desert hamster): 127226374 Help Entry 127226374         CDS       T08852                                  Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04022   cGMP-PKG signaling pathway prob04081   Hormone signaling prob04270   Vascular smooth muscle contraction prob05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     127226374   09133 Signaling molecules and interaction    04081 Hormone signaling     127226374  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     127226374  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     127226374  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127226374 Cytokines and neuropeptides [BR:prob04052]  Neuropeptides   Unclassified    127226374 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  127226374 NCBI-ProteinID:  XP_051046309 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLIACALLLTLLSLRPSEAKPGTPPKVPRTPPGEELAEPQAAGGNQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgatcgcctgtgccctgctgctcacgctactctcactccggccc tccgaagccaagcccgggacgccaccgaaggtcccgcgaacccctcctggggaggagctg gctgagccccaggcagccggcggcaatcagaaaaagggtgacaagactccaggcggcggg ggcgccaatctcaagggagaccgatcgcgactgctccgggacctgcgcgtagacaccaag tcccgggctgcttgggcccgccttctgcacgagcaccctaacgcgcgcaaatacaaaggc ggcaacaagaagggcttgtccaaaggctgctttggcctcaagctggaccggatcggctcc atgagcggtctgggatgttag

DBGET integrated database retrieval system