Phodopus roborovskii (desert hamster): 127227016 Help Entry 127227016         CDS       T08852                                  Symbol Sst Name (RefSeq) somatostatin   KO K05237   somatostatin Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04024   cAMP signaling pathway prob04080   Neuroactive ligand-receptor interaction prob04081   Hormone signaling prob04935   Growth hormone synthesis, secretion and action prob04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     127227016 (Sst)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     127227016 (Sst)    04081 Hormone signaling     127227016 (Sst)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     127227016 (Sst)   09154 Digestive system    04971 Gastric acid secretion     127227016 (Sst)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127227016 (Sst) Cytokines and neuropeptides [BR:prob04052]  Neuropeptides   GPCR binding    127227016 (Sst) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin Motif Other DBs NCBI-GeneID:  127227016 NCBI-ProteinID:  XP_051047194 UniProt:  A0AAU9ZJ35 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MLSCRLQCALAVLCIVLALGGVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgctgtcctgccgcctccagtgcgcgctggccgtgctctgcatcgtcctggccttgggc ggtgtcaccggggcgccctcggaccccagactccgtcagtttctgcagaagtctctggcg gctgctgcaggaaaacaggaactggccaagtacttcctggcagagctgctgtccgaaccc aaccagactgagaatgatgccctggagcccgaggatttgccccaggccgcggagcaggat gaaatgaggctggagctgcagaggtctgccaattcgaacccagccatggcaccccgggaa cgcaaagctggctgcaagaacttcttctggaagacattcacatcctgttag

DBGET integrated database retrieval system