Phodopus roborovskii (desert hamster): 127227503 Help Entry 127227503         CDS       T08852                                  Symbol Sod1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04146   Peroxisome prob04213   Longevity regulating pathway - multiple species prob05012   Parkinson disease prob05014   Amyotrophic lateral sclerosis prob05016   Huntington disease prob05020   Prion disease prob05022   Pathways of neurodegeneration - multiple diseases prob05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:prob00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     127227503 (Sod1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     127227503 (Sod1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     127227503 (Sod1)   09164 Neurodegenerative disease    05012 Parkinson disease     127227503 (Sod1)    05014 Amyotrophic lateral sclerosis     127227503 (Sod1)    05016 Huntington disease     127227503 (Sod1)    05020 Prion disease     127227503 (Sod1)    05022 Pathways of neurodegeneration - multiple diseases     127227503 (Sod1) Enzymes [BR:prob01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      127227503 (Sod1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  127227503 NCBI-ProteinID:  XP_051047825 UniProt:  A0AAU9ZIM9 LinkDB All DBs Position Unknown AA seq 154 aa AA seqDB search MATKAVCVLKGDGPVQGTIRFEQKASGEPVVVSGQITGLTEGQHGFHVHQFGDNTQGCTS AGPHFNPHSKKHGGPEDQERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVV HEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggcgacgaaggccgtgtgcgtgctgaagggcgacggcccggtgcagggcaccatccgc ttcgagcagaaggcaagtggtgaaccagttgtggtatcaggacaaattacaggattgact gaaggccagcatgggttccacgttcatcagtttggggataatacgcaaggctgtaccagt gcaggccctcactttaatcctcactccaagaagcatggtggaccagaggaccaagaaagg cacgttggagacctgggcaatgtgactgctgggaaggatggtgtggccaatgtgtccatt gaagatcgtgtgatctcactctcaggagagcattccatcattggccgaacaatggtggtc catgagaagcaagacgacttgggcaaaggtgggaatgaggaaagtacaaagactgggaac gcgggcagccgcttggcttgtggagtgattgggattgcccagtaa

DBGET integrated database retrieval system