Phodopus roborovskii (desert hamster): 127228373 Help Entry 127228373         CDS       T08852                                  Symbol Myl11 Name (RefSeq) myosin regulatory light chain 11   KO K12758   fast skeletal myosin light chain 2 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04510   Focal adhesion prob04520   Adherens junction prob04670   Leukocyte transendothelial migration prob04810   Regulation of actin cytoskeleton prob04814   Motor proteins prob04820   Cytoskeleton in muscle cells prob05132   Salmonella infection Brite KEGG Orthology (KO) [BR:prob00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     127228373 (Myl11)    04520 Adherens junction     127228373 (Myl11)   09142 Cell motility    04814 Motor proteins     127228373 (Myl11)    04820 Cytoskeleton in muscle cells     127228373 (Myl11)    04810 Regulation of actin cytoskeleton     127228373 (Myl11)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     127228373 (Myl11)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127228373 (Myl11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:prob04812]     127228373 (Myl11)    04147 Exosome [BR:prob04147]     127228373 (Myl11) Cytoskeleton proteins [BR:prob04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      127228373 (Myl11) Exosome [BR:prob04147]  Exosomal proteins   Exosomal proteins of hepatic cells    127228373 (Myl11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF_EFCAB10_C SAPC2_N AIF-1 Motif Other DBs NCBI-GeneID:  127228373 NCBI-ProteinID:  XP_051048997 LinkDB All DBs Position Unknown AA seq 169 aa AA seqDB search MAPKKAKRRAAAEGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKQFL EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atggcacccaagaaggccaagagaagggcagcagcagaagggagctccaatgtcttctcc atgtttgatcagactcagatccaggagttcaaggaggcttttactgtaattgaccagaac cgggatggcattattgacaaggaggatctccgagacacctttgcagccatgggccgtctc aatgtgaagaacgaggaactcgatgccatgatgaaggaagccagtggtcccatcaacttc actgtcttcctgaccatgtttggagaaaagcttaagggtgcagaccccgaggatgtgatc actggagccttcaaggtcctggacccagaggggaagggcaccatcaagaagcaattcctg gaggagctgcttaccacacagtgtgacagattttcccaggaggagatcaagaacatgtgg gcagcattccctccagatgtgggcggcaacgtagactacaagaacatctgctatgtcatc acacacggtgacgctaaggaccaggaatag

DBGET integrated database retrieval system