Phodopus roborovskii (desert hamster): 127228545 Help Entry 127228545         CDS       T08852                                  Symbol Bcl2l1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism prob  Phodopus roborovskii (desert hamster) Pathway prob01521   EGFR tyrosine kinase inhibitor resistance prob01524   Platinum drug resistance prob04014   Ras signaling pathway prob04064   NF-kappa B signaling pathway prob04115   p53 signaling pathway prob04137   Mitophagy - animal prob04140   Autophagy - animal prob04151   PI3K-Akt signaling pathway prob04210   Apoptosis prob04215   Apoptosis - multiple species prob04621   NOD-like receptor signaling pathway prob04630   JAK-STAT signaling pathway prob05012   Parkinson disease prob05014   Amyotrophic lateral sclerosis prob05022   Pathways of neurodegeneration - multiple diseases prob05145   Toxoplasmosis prob05162   Measles prob05166   Human T-cell leukemia virus 1 infection prob05168   Herpes simplex virus 1 infection prob05170   Human immunodeficiency virus 1 infection prob05200   Pathways in cancer prob05202   Transcriptional misregulation in cancer prob05212   Pancreatic cancer prob05220   Chronic myeloid leukemia prob05222   Small cell lung cancer prob05225   Hepatocellular carcinoma prob05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     127228545 (Bcl2l1)    04630 JAK-STAT signaling pathway     127228545 (Bcl2l1)    04064 NF-kappa B signaling pathway     127228545 (Bcl2l1)    04151 PI3K-Akt signaling pathway     127228545 (Bcl2l1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127228545 (Bcl2l1)    04137 Mitophagy - animal     127228545 (Bcl2l1)   09143 Cell growth and death    04210 Apoptosis     127228545 (Bcl2l1)    04215 Apoptosis - multiple species     127228545 (Bcl2l1)    04115 p53 signaling pathway     127228545 (Bcl2l1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     127228545 (Bcl2l1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127228545 (Bcl2l1)    05202 Transcriptional misregulation in cancer     127228545 (Bcl2l1)   09162 Cancer: specific types    05212 Pancreatic cancer     127228545 (Bcl2l1)    05225 Hepatocellular carcinoma     127228545 (Bcl2l1)    05220 Chronic myeloid leukemia     127228545 (Bcl2l1)    05222 Small cell lung cancer     127228545 (Bcl2l1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     127228545 (Bcl2l1)    05170 Human immunodeficiency virus 1 infection     127228545 (Bcl2l1)    05162 Measles     127228545 (Bcl2l1)    05168 Herpes simplex virus 1 infection     127228545 (Bcl2l1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     127228545 (Bcl2l1)   09164 Neurodegenerative disease    05012 Parkinson disease     127228545 (Bcl2l1)    05014 Amyotrophic lateral sclerosis     127228545 (Bcl2l1)    05022 Pathways of neurodegeneration - multiple diseases     127228545 (Bcl2l1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127228545 (Bcl2l1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     127228545 (Bcl2l1)    01524 Platinum drug resistance     127228545 (Bcl2l1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:prob01009]     127228545 (Bcl2l1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:prob03036]     127228545 (Bcl2l1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:prob02000]     127228545 (Bcl2l1) Protein phosphatases and associated proteins [BR:prob01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      127228545 (Bcl2l1) Chromosome and associated proteins [BR:prob03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     127228545 (Bcl2l1) Transporters [BR:prob02000]  Other transporters   Pores ion channels [TC:1]    127228545 (Bcl2l1) SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  127228545 NCBI-ProteinID:  XP_051049338 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREMIPMAAVKQTLREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctagtggttgactttctctcctacaagctctcccagaaa gggtacagctggagccagtttagtgatgtcgaagagaacaggactgaggccccagaagga actgaatcagagagggagacccccagtgccatcaatggcaacccatcctggcacctggcg gacagccccgcggtgaatggagccacgggccacagcagcagtttggatgcacgggagatg atccccatggcagcagtgaagcaaacgctgagagaggccggtgatgagtttgaactgcgg taccggcgggcattcagcgatctcacatcccagcttcatataaccccagggactgcatat caaagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggtggagccttgtgtgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaagttggatggccacctacctgaatgaccacctagagcct tggatccaggacaacggcggctgggacactttcgtggaactctatgggaacaatgcagca gctgagagccggaaaggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctcgctcttcagtcggaagtga

DBGET integrated database retrieval system