KEGG   Phodopus roborovskii (desert hamster): 127228621
Entry
127228621         CDS       T08852                                 
Symbol
Ndufv1
Name
(RefSeq) NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
  KO
K03942  NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:7.1.1.2]
Organism
prob  Phodopus roborovskii (desert hamster)
Pathway
prob00190  Oxidative phosphorylation
prob01100  Metabolic pathways
prob04714  Thermogenesis
prob04723  Retrograde endocannabinoid signaling
prob04932  Non-alcoholic fatty liver disease
prob05010  Alzheimer disease
prob05012  Parkinson disease
prob05014  Amyotrophic lateral sclerosis
prob05016  Huntington disease
prob05020  Prion disease
prob05022  Pathways of neurodegeneration - multiple diseases
prob05208  Chemical carcinogenesis - reactive oxygen species
prob05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:prob00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    127228621 (Ndufv1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    127228621 (Ndufv1)
  09159 Environmental adaptation
   04714 Thermogenesis
    127228621 (Ndufv1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    127228621 (Ndufv1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    127228621 (Ndufv1)
   05012 Parkinson disease
    127228621 (Ndufv1)
   05014 Amyotrophic lateral sclerosis
    127228621 (Ndufv1)
   05016 Huntington disease
    127228621 (Ndufv1)
   05020 Prion disease
    127228621 (Ndufv1)
   05022 Pathways of neurodegeneration - multiple diseases
    127228621 (Ndufv1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    127228621 (Ndufv1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    127228621 (Ndufv1)
Enzymes [BR:prob01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     127228621 (Ndufv1)
SSDB
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB_2 SLBB
Other DBs
NCBI-GeneID: 127228621
NCBI-ProteinID: XP_051049493
UniProt: A0AAU9ZL61
LinkDB
Position
Unknown
AA seq 462 aa
MLAARQLLGGSLPLRVSVRFSSGTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQRRG
DWYKTKEILLKGPDWILGEIKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREIMRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSDYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGAWFAGFGRERNSGTKLFNISGHVNNPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEERMQQFAHQAQHANF
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgctagcggcacggcagcttctcggcggatcgcttcccttgcgggtatctgtgcgtttc
agcagcggcacgacagcacccaagaaaacctcatttggctcgctgaaggatgaagaccgg
attttcaccaacctctatggccgccatgactggaggctgaaaggtgcccagcgtcggggt
gactggtacaagacaaaggagatcctgctgaaagggcctgactggatcttgggtgagatc
aagacatctggcttacggggccgtggcggtgctggcttccccactggcctcaaatggagc
ttcatgaataagccctcagatgggaggcccaagtatctggtggtgaatgctgacgaggga
gagccagggacctgtaaggaccgagagatcatgcgccatgaccctcataagctggtggag
ggctgcctggtggggggccgggccatgggcgcccgggctgcctacatctacatccgaggg
gagttctacaatgaagcctccaatctgcaggtagctatccgagaggcctatgaagcaggt
cttattggcaagaatgcctgtggctctgactatgattttgacgtgtttgtggtgcgtggg
gccggagcctacatttgtggagaggagacggcactcattgagtccattgagggcaagcag
ggaaagccacgcctgaagccaccctttccagcagatgtgggagtgtttggatgccccaca
actgtggccaatgtggagacagtggctgtgtcccccaccatctgccgtcgggggggtgcc
tggtttgctggctttggccgagaacgcaactcaggtaccaaactgttcaacatctctggc
catgtcaacaacccctgcactgtggaggaggagatgtctgtgccactgaaggagctgatt
gagaagcatgctggtggtgtcactggtggctgggacaacctccttgctgtgattcctggt
ggatcatccactccgctgatccctaagtctgtgtgtgagacagtgttgatggactttgat
gcactggtgcaggcccagacaggcctgggcacagctgcagtgattgtcatggatcgctcg
acagacattgtgaaagctattgctcgtctcattgagttctataagcatgagagctgtggc
cagtgtaccccatgccgtgagggtgtcgactggatgaacaaagtaatggcccgctttgtg
aagggggatgcccggccagctgagattgactccctgtgggagatcagcaagcagatagag
ggccacaccatttgcgctctgggtgatggggccgcctggccagtacagggtctgatccga
cacttccggccagagcttgaggagcgaatgcaacagttcgcacaccaggcccagcatgca
aacttctga

DBGET integrated database retrieval system