Phodopus roborovskii (desert hamster): 127228703 Help Entry 127228703         CDS       T08852                                  Symbol Cfl1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04360   Axon guidance prob04666   Fc gamma R-mediated phagocytosis prob04810   Regulation of actin cytoskeleton prob05133   Pertussis prob05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:prob00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     127228703 (Cfl1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     127228703 (Cfl1)   09158 Development and regeneration    04360 Axon guidance     127228703 (Cfl1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     127228703 (Cfl1)   09171 Infectious disease: bacterial    05133 Pertussis     127228703 (Cfl1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:prob04131]     127228703 (Cfl1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:prob04812]     127228703 (Cfl1)    04147 Exosome [BR:prob04147]     127228703 (Cfl1) Membrane trafficking [BR:prob04131]  Others   Actin-binding proteins    Others     127228703 (Cfl1) Cytoskeleton proteins [BR:prob04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      127228703 (Cfl1) Exosome [BR:prob04147]  Exosomal proteins   Proteins found in most exosomes    127228703 (Cfl1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  127228703 NCBI-ProteinID:  XP_051049612 UniProt:  A0AAU9ZNM2 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYTTFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctctggtgtggctgtctcggatggtgtcatcaaggtattcaatgacatgaaggtg cgcaagtcttcaacgccagaagaagtgaagaaacgcaagaaggcagtgcttttctgcctg agtgaggacaagaaaaacatcatcctggaggaggggaaggagatcctggtaggagatgtg gggcagactgtggacgacccctacaccacttttgtcaagatgctgccagacaaggactgc cgctatgctctctatgatgcgacctatgagaccaaggagagcaagaaggaggacctggtg ttcatcttctgggcccctgagagtgcaccccttaagagcaaaatgatctatgccagctcc aaggatgccatcaagaagaagctgaccggaatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagaaaagctaggtggcagcgctgtcatctct ctggagggcaagcctttgtga

DBGET integrated database retrieval system