Phodopus roborovskii (desert hamster): 127230328 Help Entry 127230328         CDS       T08852                                  Symbol Fgf9 Name (RefSeq) fibroblast growth factor 9   KO K04358   fibroblast growth factor Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04010   MAPK signaling pathway prob04014   Ras signaling pathway prob04015   Rap1 signaling pathway prob04020   Calcium signaling pathway prob04151   PI3K-Akt signaling pathway prob04810   Regulation of actin cytoskeleton prob05200   Pathways in cancer prob05207   Chemical carcinogenesis - receptor activation prob05218   Melanoma prob05224   Breast cancer prob05226   Gastric cancer Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127230328 (Fgf9)    04014 Ras signaling pathway     127230328 (Fgf9)    04015 Rap1 signaling pathway     127230328 (Fgf9)    04020 Calcium signaling pathway     127230328 (Fgf9)    04151 PI3K-Akt signaling pathway     127230328 (Fgf9)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     127230328 (Fgf9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127230328 (Fgf9)    05207 Chemical carcinogenesis - receptor activation     127230328 (Fgf9)   09162 Cancer: specific types    05226 Gastric cancer     127230328 (Fgf9)    05218 Melanoma     127230328 (Fgf9)    05224 Breast cancer     127230328 (Fgf9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127230328 (Fgf9)    00536 Glycosaminoglycan binding proteins [BR:prob00536]     127230328 (Fgf9) Cytokines and neuropeptides [BR:prob04052]  Cytokines   Growth factors (RTK binding)    127230328 (Fgf9) Glycosaminoglycan binding proteins [BR:prob00536]  Heparan sulfate / Heparin   Growth factors/receptors    127230328 (Fgf9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  127230328 NCBI-ProteinID:  XP_051051560 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR HQKFTHFLPRPVDPDKVPELYKDILSQS NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggctcccttaggtgaagttgggagctatttcggtgtgcaggacgcggtaccgttcggg aacgtaccggtgttgccggtggacagtccggtgttgctaagtgaccacctgggtcagtct gaagcaggggggctgccccggggacccgcagtcacggacttggatcatttaaaggggatt ctcaggcggaggcagctgtactgcaggactggatttcacttagaaatcttccccaacggt actatccagggaaccaggaaagaccacagccgattcggcattctggaatttatcagtata gcagttggcctggtcagcattcgtggcgtggacagtggactctacctcggcatgaacgag aagggggagctgtacggatcagaaaaactaacacaagagtgtgtattcagagaacagttt gaagagaactggtacaacacctactcttccaacctgtataaacacgtggacaccggaagg agatactatgttgcattaaataaggatgggactccaagagaagggaccaggactaaaagg caccagaaatttacacattttttacctagaccagtggacccggacaaagtacctgaacta tataaggatatcttaagccaaagttga

DBGET integrated database retrieval system