Phodopus roborovskii (desert hamster): 127230596 Help Entry 127230596         CDS       T08852                                  Symbol Cfl2 Name (RefSeq) cofilin-2   KO K05765   cofilin Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04360   Axon guidance prob04666   Fc gamma R-mediated phagocytosis prob04810   Regulation of actin cytoskeleton prob05133   Pertussis prob05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:prob00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     127230596 (Cfl2)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     127230596 (Cfl2)   09158 Development and regeneration    04360 Axon guidance     127230596 (Cfl2)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     127230596 (Cfl2)   09171 Infectious disease: bacterial    05133 Pertussis     127230596 (Cfl2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:prob04131]     127230596 (Cfl2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:prob04812]     127230596 (Cfl2)    04147 Exosome [BR:prob04147]     127230596 (Cfl2) Membrane trafficking [BR:prob04131]  Others   Actin-binding proteins    Others     127230596 (Cfl2) Cytoskeleton proteins [BR:prob04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      127230596 (Cfl2) Exosome [BR:prob04147]  Exosomal proteins   Proteins found in most exosomes    127230596 (Cfl2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  127230596 NCBI-ProteinID:  XP_051051818 UniProt:  A0AAU9ZT60 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDI GDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGSVVVSLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcatctggagttacagtgaacgatgaagtcatcaaagtttttaatgatatgaaagta agaaaatcttctacacaagaggagatcaaaaaaagaaagaaagcagttctcttctgttta agcgatgacaaaagacaaataattgtagaggaagcaaagcagatcttggtgggtgacatt ggtgatactgtagaggacccctacacatcttttgtgaagttgctacctctgaatgattgc cgatatgctttgtacgatgccacatacgaaacaaaagagtctaagaaagaagacctagta tttatattctgggctcctgaaagtgcaccgttaaaaagcaagatgatttatgctagctct aaagatgccattaaaaagaaatttacaggcattaaacatgagtggcaagtaaatggcttg gacgatattaaggaccgctccacactgggagagaaactgggaggcagtgttgtagtttcc cttgaaggaaagccactataa

DBGET integrated database retrieval system