Phodopus roborovskii (desert hamster): 127230598 Help Entry 127230598         CDS       T08852                                  Symbol Nfkbia Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04024   cAMP signaling pathway prob04062   Chemokine signaling pathway prob04064   NF-kappa B signaling pathway prob04210   Apoptosis prob04380   Osteoclast differentiation prob04620   Toll-like receptor signaling pathway prob04621   NOD-like receptor signaling pathway prob04622   RIG-I-like receptor signaling pathway prob04623   Cytosolic DNA-sensing pathway prob04625   C-type lectin receptor signaling pathway prob04657   IL-17 signaling pathway prob04658   Th1 and Th2 cell differentiation prob04659   Th17 cell differentiation prob04660   T cell receptor signaling pathway prob04662   B cell receptor signaling pathway prob04668   TNF signaling pathway prob04722   Neurotrophin signaling pathway prob04920   Adipocytokine signaling pathway prob04926   Relaxin signaling pathway prob04931   Insulin resistance prob04936   Alcoholic liver disease prob05132   Salmonella infection prob05134   Legionellosis prob05135   Yersinia infection prob05140   Leishmaniasis prob05142   Chagas disease prob05145   Toxoplasmosis prob05160   Hepatitis C prob05161   Hepatitis B prob05162   Measles prob05163   Human cytomegalovirus infection prob05164   Influenza A prob05166   Human T-cell leukemia virus 1 infection prob05167   Kaposi sarcoma-associated herpesvirus infection prob05168   Herpes simplex virus 1 infection prob05169   Epstein-Barr virus infection prob05170   Human immunodeficiency virus 1 infection prob05171   Coronavirus disease - COVID-19 prob05200   Pathways in cancer prob05203   Viral carcinogenesis prob05208   Chemical carcinogenesis - reactive oxygen species prob05215   Prostate cancer prob05220   Chronic myeloid leukemia prob05222   Small cell lung cancer prob05235   PD-L1 expression and PD-1 checkpoint pathway in cancer prob05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     127230598 (Nfkbia)    04668 TNF signaling pathway     127230598 (Nfkbia)    04024 cAMP signaling pathway     127230598 (Nfkbia)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     127230598 (Nfkbia)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127230598 (Nfkbia)    04621 NOD-like receptor signaling pathway     127230598 (Nfkbia)    04622 RIG-I-like receptor signaling pathway     127230598 (Nfkbia)    04623 Cytosolic DNA-sensing pathway     127230598 (Nfkbia)    04625 C-type lectin receptor signaling pathway     127230598 (Nfkbia)    04660 T cell receptor signaling pathway     127230598 (Nfkbia)    04658 Th1 and Th2 cell differentiation     127230598 (Nfkbia)    04659 Th17 cell differentiation     127230598 (Nfkbia)    04657 IL-17 signaling pathway     127230598 (Nfkbia)    04662 B cell receptor signaling pathway     127230598 (Nfkbia)    04062 Chemokine signaling pathway     127230598 (Nfkbia)   09152 Endocrine system    04920 Adipocytokine signaling pathway     127230598 (Nfkbia)    04926 Relaxin signaling pathway     127230598 (Nfkbia)   09156 Nervous system    04722 Neurotrophin signaling pathway     127230598 (Nfkbia)   09158 Development and regeneration    04380 Osteoclast differentiation     127230598 (Nfkbia)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127230598 (Nfkbia)    05208 Chemical carcinogenesis - reactive oxygen species     127230598 (Nfkbia)    05203 Viral carcinogenesis     127230598 (Nfkbia)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     127230598 (Nfkbia)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     127230598 (Nfkbia)    05215 Prostate cancer     127230598 (Nfkbia)    05222 Small cell lung cancer     127230598 (Nfkbia)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     127230598 (Nfkbia)    05170 Human immunodeficiency virus 1 infection     127230598 (Nfkbia)    05161 Hepatitis B     127230598 (Nfkbia)    05160 Hepatitis C     127230598 (Nfkbia)    05171 Coronavirus disease - COVID-19     127230598 (Nfkbia)    05164 Influenza A     127230598 (Nfkbia)    05162 Measles     127230598 (Nfkbia)    05168 Herpes simplex virus 1 infection     127230598 (Nfkbia)    05163 Human cytomegalovirus infection     127230598 (Nfkbia)    05167 Kaposi sarcoma-associated herpesvirus infection     127230598 (Nfkbia)    05169 Epstein-Barr virus infection     127230598 (Nfkbia)   09171 Infectious disease: bacterial    05132 Salmonella infection     127230598 (Nfkbia)    05135 Yersinia infection     127230598 (Nfkbia)    05134 Legionellosis     127230598 (Nfkbia)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     127230598 (Nfkbia)    05140 Leishmaniasis     127230598 (Nfkbia)    05142 Chagas disease     127230598 (Nfkbia)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127230598 (Nfkbia)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     127230598 (Nfkbia)    04931 Insulin resistance     127230598 (Nfkbia)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:prob03000]     127230598 (Nfkbia)    04131 Membrane trafficking [BR:prob04131]     127230598 (Nfkbia) Transcription factors [BR:prob03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     127230598 (Nfkbia) Membrane trafficking [BR:prob04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     127230598 (Nfkbia) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  127230598 NCBI-ProteinID:  XP_051051820 UniProt:  A0AAU9ZSI1 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELQEIRLQPQEAP LAAEPWKQQLTEDGDSFLHLAIIHEEKTLTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPGIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCTPQHLHSILQATN YNGHTCLHLASIHGYLGIVEHLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGHSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVFGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcagccagccggccacggccaggactgggccatggagggcccgcgggacggcctc aagaaggagcggctggtggacgatcgccacgacagcggcctggattccatgaaggacgag gagtacgagcagatggtgaaggagctgcaggagatccgcctgcagccgcaagaggcgccg ctggccgccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg gcgatcatccatgaagagaagactctgaccatggaagtgatccggcaggtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccccttcacttggctgtgatc accaaccagccaggaattgctgaggcacttttggaagctggctgtgatcctgagctccga gactttcgaggaaatacccctctccaccttgcctgtgagcagggctgtctggccagcgta ggagtcctgacacagacttgcacacctcagcatctccactccatcctgcaggccaccaat tacaatggccacacatgtctgcacctggcctccatccatggctacctgggcatcgtggag catttggtgtctttgggtgccgatgtcaatgcacaggagccctgcaatggccggacagct ctccaccttgcagtggacctgcagaacccagacctggtgtcgctcttgttgaagtgtggg gctgatgtcaacagagtaacctaccaaggccactccccctatcagcttacctggggccga ccaagtacccggatacagcagcagctgggccagctgaccctggaaaatcttcagatgctg cccgaaagtgaggatgaggagagctatgacacagagtcagaattcacggaggatgagctg ccctatgatgactgtgtatttggaggccagcgtctgacattatga

DBGET integrated database retrieval system