Phodopus roborovskii (desert hamster): 127230644 Help Entry 127230644         CDS       T08852                                  Symbol Arf6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04014   Ras signaling pathway prob04072   Phospholipase D signaling pathway prob04144   Endocytosis prob04666   Fc gamma R-mediated phagocytosis prob05132   Salmonella infection prob05135   Yersinia infection Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     127230644 (Arf6)    04072 Phospholipase D signaling pathway     127230644 (Arf6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127230644 (Arf6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     127230644 (Arf6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127230644 (Arf6)    05135 Yersinia infection     127230644 (Arf6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:prob04131]     127230644 (Arf6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:prob04147]     127230644 (Arf6)    04031 GTP-binding proteins [BR:prob04031]     127230644 (Arf6) Membrane trafficking [BR:prob04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     127230644 (Arf6)   Arf GTPases and associated proteins    Arf GTPases     127230644 (Arf6) Exosome [BR:prob04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127230644 (Arf6)   Exosomal proteins of colorectal cancer cells    127230644 (Arf6) GTP-binding proteins [BR:prob04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     127230644 (Arf6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  127230644 NCBI-ProteinID:  XP_051051883 UniProt:  A0AAU9ZQI6 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctatccaagatcttcgggaacaaggaaatgcggatcctcatgctgggc ctggacgcagccggcaagacgacgatcctgtacaagttgaagctgggccagtctgtgacc accattcccacggtgggtttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtgtgggatgtgggcggccaggacaagatccggccgctatggcggcattactacaccggg acccagggtctgatcttcgtggtggactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc gccaacaagcaggacctgcccgatgccatgaaaccccatgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctctggggac ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system