Phodopus roborovskii (desert hamster): 127231601 Help Entry 127231601         CDS       T08852                                  Name (RefSeq) histone H2AX   KO K11251   histone H2A Organism prob  Phodopus roborovskii (desert hamster) Pathway prob03082   ATP-dependent chromatin remodeling prob04217   Necroptosis prob04613   Neutrophil extracellular trap formation prob05034   Alcoholism prob05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:prob00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     127231601  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     127231601  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     127231601  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     127231601   09165 Substance dependence    05034 Alcoholism     127231601  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:prob03036]     127231601   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:prob04147]     127231601 Chromosome and associated proteins [BR:prob03036]  Eukaryotic type   Nucleosome assembly factors    Histones     127231601 Exosome [BR:prob04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127231601 SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Histone_ABTB CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  127231601 NCBI-ProteinID:  XP_051053192 LinkDB All DBs Position Unknown AA seq 143 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSATVGPKAPAGGKKATQASQEY NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtcgggtcgtggcaaaaccggaggcaaggcccgcgccaaggccaagtcgcgctcctcg cgcgccggcctacagttcccggtaggccgcgtgcaccggctgctgcggaaaggccactat gccgagcgcgtgggcgccggcgccccggtgtacctggcggccgtgctcgagtacctcacc gctgagattctggagctggcgggcaatgcggcgcgggacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagcttctgggcggc gtgacgatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag acgagcgccaccgtggggcctaaggcgccggcgggcggcaagaaggccacccaggcctct caggagtactaa

DBGET integrated database retrieval system