Phodopus roborovskii (desert hamster): 127231862 Help Entry 127231862         CDS       T08852                                  Symbol Calml4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04014   Ras signaling pathway prob04015   Rap1 signaling pathway prob04020   Calcium signaling pathway prob04022   cGMP-PKG signaling pathway prob04024   cAMP signaling pathway prob04070   Phosphatidylinositol signaling system prob04114   Oocyte meiosis prob04218   Cellular senescence prob04261   Adrenergic signaling in cardiomyocytes prob04270   Vascular smooth muscle contraction prob04371   Apelin signaling pathway prob04625   C-type lectin receptor signaling pathway prob04713   Circadian entrainment prob04720   Long-term potentiation prob04722   Neurotrophin signaling pathway prob04728   Dopaminergic synapse prob04740   Olfactory transduction prob04744   Phototransduction prob04750   Inflammatory mediator regulation of TRP channels prob04910   Insulin signaling pathway prob04912   GnRH signaling pathway prob04915   Estrogen signaling pathway prob04916   Melanogenesis prob04921   Oxytocin signaling pathway prob04922   Glucagon signaling pathway prob04924   Renin secretion prob04925   Aldosterone synthesis and secretion prob04970   Salivary secretion prob04971   Gastric acid secretion prob05010   Alzheimer disease prob05012   Parkinson disease prob05022   Pathways of neurodegeneration - multiple diseases prob05031   Amphetamine addiction prob05034   Alcoholism prob05133   Pertussis prob05152   Tuberculosis prob05163   Human cytomegalovirus infection prob05167   Kaposi sarcoma-associated herpesvirus infection prob05170   Human immunodeficiency virus 1 infection prob05200   Pathways in cancer prob05214   Glioma prob05417   Lipid and atherosclerosis prob05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     127231862 (Calml4)    04015 Rap1 signaling pathway     127231862 (Calml4)    04371 Apelin signaling pathway     127231862 (Calml4)    04020 Calcium signaling pathway     127231862 (Calml4)    04070 Phosphatidylinositol signaling system     127231862 (Calml4)    04024 cAMP signaling pathway     127231862 (Calml4)    04022 cGMP-PKG signaling pathway     127231862 (Calml4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     127231862 (Calml4)    04218 Cellular senescence     127231862 (Calml4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127231862 (Calml4)   09152 Endocrine system    04910 Insulin signaling pathway     127231862 (Calml4)    04922 Glucagon signaling pathway     127231862 (Calml4)    04912 GnRH signaling pathway     127231862 (Calml4)    04915 Estrogen signaling pathway     127231862 (Calml4)    04921 Oxytocin signaling pathway     127231862 (Calml4)    04916 Melanogenesis     127231862 (Calml4)    04924 Renin secretion     127231862 (Calml4)    04925 Aldosterone synthesis and secretion     127231862 (Calml4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     127231862 (Calml4)    04270 Vascular smooth muscle contraction     127231862 (Calml4)   09154 Digestive system    04970 Salivary secretion     127231862 (Calml4)    04971 Gastric acid secretion     127231862 (Calml4)   09156 Nervous system    04728 Dopaminergic synapse     127231862 (Calml4)    04720 Long-term potentiation     127231862 (Calml4)    04722 Neurotrophin signaling pathway     127231862 (Calml4)   09157 Sensory system    04744 Phototransduction     127231862 (Calml4)    04740 Olfactory transduction     127231862 (Calml4)    04750 Inflammatory mediator regulation of TRP channels     127231862 (Calml4)   09159 Environmental adaptation    04713 Circadian entrainment     127231862 (Calml4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127231862 (Calml4)   09162 Cancer: specific types    05214 Glioma     127231862 (Calml4)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     127231862 (Calml4)    05163 Human cytomegalovirus infection     127231862 (Calml4)    05167 Kaposi sarcoma-associated herpesvirus infection     127231862 (Calml4)   09171 Infectious disease: bacterial    05133 Pertussis     127231862 (Calml4)    05152 Tuberculosis     127231862 (Calml4)   09164 Neurodegenerative disease    05010 Alzheimer disease     127231862 (Calml4)    05012 Parkinson disease     127231862 (Calml4)    05022 Pathways of neurodegeneration - multiple diseases     127231862 (Calml4)   09165 Substance dependence    05031 Amphetamine addiction     127231862 (Calml4)    05034 Alcoholism     127231862 (Calml4)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127231862 (Calml4)    05418 Fluid shear stress and atherosclerosis     127231862 (Calml4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:prob01009]     127231862 (Calml4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:prob04131]     127231862 (Calml4)    03036 Chromosome and associated proteins [BR:prob03036]     127231862 (Calml4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:prob04147]     127231862 (Calml4) Protein phosphatases and associated proteins [BR:prob01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      127231862 (Calml4) Membrane trafficking [BR:prob04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     127231862 (Calml4) Chromosome and associated proteins [BR:prob03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      127231862 (Calml4) Exosome [BR:prob04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    127231862 (Calml4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_9 EF-hand_6 EF-hand_8 EF-hand_1 AIF-1 EF-hand_11 Motif Other DBs NCBI-GeneID:  127231862 NCBI-ProteinID:  XP_051053667 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MAKFLSQDQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDK HGELDFSTFLTIMHNQIKQEDPKKEILLAMLMADKEKKGYIMASELRSKLMKLGEKLTHK EVDDLFKEAGIEPNGQVKYDTFIQRITLPVQDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggccaagttcctttcccaggaccaaattaatgagtacaaagaatgcttctccctgtat gacaagcagcaaagagggaagattaaggccacggatcttctggtgtccatgaggtgcctg ggcgccagccccacgcctggagaagtacagaggcacctgcagactcatgggatagacaag cacggagagctggatttctccaccttcctgaccattatgcacaaccaaatcaaacaagag gacccaaagaaagaaatccttctggcaatgctgatggcagacaaggagaagaaaggttac atcatggcatctgagttgcggtcaaaactcatgaaactgggagagaagctcactcacaag gaagtggatgatcttttcaaggaagcaggcatcgaaccaaatggccaagtgaaatatgac acttttatccaaaggatcacccttcctgtgcaagactactga

DBGET integrated database retrieval system