Phodopus roborovskii (desert hamster): 127232099 Help Entry 127232099         CDS       T08852                                  Name (RefSeq) platelet factor 4   KO K05407   platelet factor 4 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04060   Cytokine-cytokine receptor interaction prob04061   Viral protein interaction with cytokine and cytokine receptor prob04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127232099    04061 Viral protein interaction with cytokine and cytokine receptor     127232099  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     127232099  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127232099    00536 Glycosaminoglycan binding proteins [BR:prob00536]     127232099 Cytokines and neuropeptides [BR:prob04052]  Cytokines   Chemokines    127232099 Glycosaminoglycan binding proteins [BR:prob00536]  Heparan sulfate / Heparin   Chemokines    127232099 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  127232099 NCBI-ProteinID:  XP_051054023 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MSATMVCRGPWLSPGLLLLGLLLLPAAIAFTSASPEEGDADLHCVCVKTISSGIHPKHIT TLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKLLES NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgagtgccactatggtgtgtcgaggcccctggctcagccctgggctgcttctcctgggt ctgttgcttcttccagctgcgattgccttcaccagcgctagccctgaagaaggcgatgca gatcttcattgtgtgtgtgtgaagaccatctcctcggggatccaccctaagcatatcacc accctggaggtgatcaaggcaggacgccattgtgcggttccccagctcatagccactttg aagaatgggaggaaaatttgcctggaccggcaagcacctttatataagaaagtgatcaag aaactcctggagagctag

DBGET integrated database retrieval system