Phodopus roborovskii (desert hamster): 127232215 Help Entry 127232215         CDS       T08852                                  Symbol Cxcl9 Name (RefSeq) C-X-C motif chemokine 9   KO K05416   C-X-C motif chemokine 9 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04060   Cytokine-cytokine receptor interaction prob04061   Viral protein interaction with cytokine and cytokine receptor prob04062   Chemokine signaling pathway prob04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:prob00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127232215 (Cxcl9)    04061 Viral protein interaction with cytokine and cytokine receptor     127232215 (Cxcl9)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127232215 (Cxcl9)    04062 Chemokine signaling pathway     127232215 (Cxcl9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:prob04052]     127232215 (Cxcl9) Cytokines and neuropeptides [BR:prob04052]  Cytokines   Chemokines    127232215 (Cxcl9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Rtf2 MRP-S27 Motif Other DBs NCBI-GeneID:  127232215 NCBI-ProteinID:  XP_051054173 UniProt:  A0AAU9ZWR7 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MKSTVLFLLGIILLDQCGVQGTLVIRSHRCSCISTSRGSIHYRSLRDLKQFAPSPHCNKT EIIATLKSGTQTCLNPDSANVKKLIKEWEKQISQKKKQKRGRKQQKNKKTGKAKKPKGPH AKTP NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgaagtcaactgttctttttctcttgggtatcattctcctggaccagtgtggggttcaa ggaaccctagtcataaggagtcatcgttgctcctgcatcagcaccagccgaggctcgatc cactacaggtccttaagagatctcaaacagtttgcccccagccctcattgcaacaaaact gaaatcatcgctacactgaagagtggtactcaaacctgtctgaacccagattcggcaaat gtaaagaagctgataaaagaatgggagaaacagatcagccaaaagaagaagcaaaaaagg gggagaaaacagcaaaagaacaagaaaactggaaaagctaaaaaacccaaaggtcctcat gcaaagactccctaa

DBGET integrated database retrieval system