Phodopus roborovskii (desert hamster): 127236113 Help Entry 127236113         CDS       T08852                                  Symbol Brk1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism prob  Phodopus roborovskii (desert hamster) Pathway prob04810   Regulation of actin cytoskeleton prob05132   Salmonella infection Brite KEGG Orthology (KO) [BR:prob00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     127236113 (Brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127236113 (Brk1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CCDC53 SPX DUF7310 Hydro_N_hd Matrilin_ccoil Motif Other DBs NCBI-GeneID:  127236113 NCBI-ProteinID:  XP_051059509 UniProt:  A0AAV0A5G7 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctggacaagaggatccggtgcagcgggagattcaccaggactgggcgaatcgggag tacattgagatcatcactagcagcatcaagaaaatctcggactttctcaactctttcgat atgtcttgtcgatcaagactcgcaacactaaatgagaaattgacagcccttgaacggaga atagagtacattgaagcaagggtgacaaagggtgagactctcacctag

DBGET integrated database retrieval system